Difference between revisions of "Os03g0766100"

From RiceWiki
Jump to: navigation, search
(References)
(References)
Line 18: Line 18:
  
 
==References==
 
==References==
[1] Pai-Hsiang Su; Su-May Yu; Ching-San Chen. Expression analyses of a rice 10 kDa sulfur-rich prolamin gene. Botanical Bulletin of Academia Sinica, 2004, 45(2): 101-109.
+
<ref name="ref1">Pai-Hsiang Su; Su-May Yu; Ching-San Chen. Expression analyses of a rice 10 kDa sulfur-rich prolamin gene. Botanical Bulletin of Academia Sinica, 2004, 45(2): 101-109.
  
[2] Ai Nagamine; Hiroaki Matsusaka; Tomokazu Ushijima; Yasushi Kawagoe; Masahiro Ogawa; Thomas W. Okita; Toshihiro Kumamaru.  A Role for the Cysteine-Rich 10 kDa Prolamin in Protein Body I Formation in Rice Plant and Cell Physiology, 2011, 52(6): 1003-1016
+
<ref name="ref2">Ai Nagamine; Hiroaki Matsusaka; Tomokazu Ushijima; Yasushi Kawagoe; Masahiro Ogawa; Thomas W. Okita; Toshihiro Kumamaru.  A Role for the Cysteine-Rich 10 kDa Prolamin in Protein Body I Formation in Rice Plant and Cell Physiology, 2011, 52(6): 1003-1016
  
[3] Yayoi Onda; Ai Nagamine; Mutsumi Sakurai; Toshihiro Kumamaru; Masahiro Ogawa; Yasushi Kawagoe. Distinct Roles of Protein Disulfide Isomerase and P5 Sulfhydryl Oxidoreductases in Multiple Pathways for Oxidation of Structurally Diverse Storage Proteins in Rice The Plant Cell, 2011, 23(1): 210-223
+
<ref name="ref3">Yayoi Onda; Ai Nagamine; Mutsumi Sakurai; Toshihiro Kumamaru; Masahiro Ogawa; Yasushi Kawagoe. Distinct Roles of Protein Disulfide Isomerase and P5 Sulfhydryl Oxidoreductases in Multiple Pathways for Oxidation of Structurally Diverse Storage Proteins in Rice The Plant Cell, 2011, 23(1): 210-223
  
[4] Ogawa, M., Kumamaru, T., Satoh, H., Iwata, N., Omura, T., Kasai, Z. et al. (1987) Purification of protein body-I of rice seed and its polypeptide composition. Plant Cell Physiol.28: 1517–1527.
+
<ref name="ref4">Ogawa, M., Kumamaru, T., Satoh, H., Iwata, N., Omura, T., Kasai, Z. ''et al.'' (1987) Purification of protein body-I of rice seed and its polypeptide composition. Plant Cell Physiol.28: 1517–1527.
  
[5] Masumura, T., Shibata, D., Hibino, T., Kato, T., Kawabe, K., Takeba, G. et al. (1989) cDNA cloning of an mRNA encoding a sulfur-rich 10 kDa prolamin polypeptide in rice seeds. Plant Mol. Biol. 12:123–130
+
<ref name="ref5">Masumura, T., Shibata, D., Hibino, T., Kato, T., Kawabe, K., Takeba, G. ''et al.'' (1989) cDNA cloning of an mRNA encoding a sulfur-rich 10 kDa prolamin polypeptide in rice seeds. Plant Mol. Biol. 12:123–130
  
[6] Kawakatsu, T., Hirose, S., Yasuda, H. and Takaiwa, F. (2010) Reducing rice seed storage protein accumulation leads to changes in nutrient quality and storage organelle formation. Plant Physiol. 154: 1842–1854
+
<ref name="ref6">Kawakatsu, T., Hirose, S., Yasuda, H. and Takaiwa, F. (2010) Reducing rice seed storage protein accumulation leads to changes in nutrient quality and storage organelle formation. Plant Physiol. 154: 1842–1854
  
[7] Onda, Y., Kumamaru, T. and Kawagoe, Y. (2009) ER membrane localized oxidoreductase Ero1 is required for disulfide bond formation in the rice endosperm. Proc. Natl Acad. Sci. USA 106: 14156–14161
+
<ref name="ref7">Onda, Y., Kumamaru, T. and Kawagoe, Y. (2009) ER membrane localized oxidoreductase Ero1 is required for disulfide bond formation in the rice endosperm. Proc. Natl Acad. Sci. USA 106: 14156–14161
  
 
==Structured Information==
 
==Structured Information==

Revision as of 05:13, 4 June 2014

Please input one-sentence summary here.

CysR10 is essential for formation of the tightly compact, spherical shaped structure of PB-I.

Annotated Information

Function

Sulfur-rich prolamin gene CysR10 locates in chromosome 3, and encodes Cysteine-Rich 10 kDa Prolamin. RP10 [1], CysR10 [2], and crP10 [3] represent the same gene. The rice prolamins consist of 60% Cys-rich prolamins and 40% Cys-poor prolamins, and the 10, 14 and 16 kDa prolamins are Cys-rich species, while the 13 kDa prolamin is a Cys-poor species [4]. The 10 kDa prolamins (CysR10) share minimal sequence homology with the other two classes and are characterized by their high content of methionine (20%) and cysteine (10%) residues [5]. In rice, there are two types of protein bodies (PBs), called PB-I in which prolamins are accumulated as intracisternal protein granules and PB-II. These prolamin species are asymmetrically distributed within PB-I and that CysR10 is essential for formation of the tightly compact, spherical shaped structure of PB-I [2].

Expression

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

<ref name="ref1">Pai-Hsiang Su; Su-May Yu; Ching-San Chen. Expression analyses of a rice 10 kDa sulfur-rich prolamin gene. Botanical Bulletin of Academia Sinica, 2004, 45(2): 101-109.

<ref name="ref2">Ai Nagamine; Hiroaki Matsusaka; Tomokazu Ushijima; Yasushi Kawagoe; Masahiro Ogawa; Thomas W. Okita; Toshihiro Kumamaru. A Role for the Cysteine-Rich 10 kDa Prolamin in Protein Body I Formation in Rice Plant and Cell Physiology, 2011, 52(6): 1003-1016

<ref name="ref3">Yayoi Onda; Ai Nagamine; Mutsumi Sakurai; Toshihiro Kumamaru; Masahiro Ogawa; Yasushi Kawagoe. Distinct Roles of Protein Disulfide Isomerase and P5 Sulfhydryl Oxidoreductases in Multiple Pathways for Oxidation of Structurally Diverse Storage Proteins in Rice The Plant Cell, 2011, 23(1): 210-223

<ref name="ref4">Ogawa, M., Kumamaru, T., Satoh, H., Iwata, N., Omura, T., Kasai, Z. et al. (1987) Purification of protein body-I of rice seed and its polypeptide composition. Plant Cell Physiol.28: 1517–1527.

<ref name="ref5">Masumura, T., Shibata, D., Hibino, T., Kato, T., Kawabe, K., Takeba, G. et al. (1989) cDNA cloning of an mRNA encoding a sulfur-rich 10 kDa prolamin polypeptide in rice seeds. Plant Mol. Biol. 12:123–130

<ref name="ref6">Kawakatsu, T., Hirose, S., Yasuda, H. and Takaiwa, F. (2010) Reducing rice seed storage protein accumulation leads to changes in nutrient quality and storage organelle formation. Plant Physiol. 154: 1842–1854

<ref name="ref7">Onda, Y., Kumamaru, T. and Kawagoe, Y. (2009) ER membrane localized oxidoreductase Ero1 is required for disulfide bond formation in the rice endosperm. Proc. Natl Acad. Sci. USA 106: 14156–14161

Structured Information

Gene Name

Os03g0766100

Description

10 kDa prolamin precursor

Version

NM_001057915.1 GI:115455558 GeneID:4334227

Length

574 bp

Definition

Oryza sativa Japonica Group Os03g0766100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:32580334..32580907

Sequence Coding Region

32580436..32580840

Expression

GEO Profiles:Os03g0766100

Genome Context

<gbrowseImage1> name=NC_008396:32580334..32580907 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:32580334..32580907 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcagcatacaccagcaagatctttgccctgtttgccttaattgctctttctgcaagtgccactactgcaatcaccactatgcagtatttcccaccaacattagccatgggcaccatggatccgtgtaggcagtacatgatgcaaacgttgggcatgggtagctccacagccatgttcatgtcgcagccaatggcgctcctgcagcagcaatgttgcatgcagctacaaggcatgatgcctcagtgccactgtggcaccagttgccagatgatgcagagcatgcaacaagttatttgtgctggactcgggcagcagcagatgatgaagatggcgatgcagatgccatacatgtgcaacatggcccctgtcaacttccaactctcttcctgtggttgttgttga</cdnaseq>

Protein Sequence

<aaseq>MAAYTSKIFALFALIALSASATTAITTMQYFPPTLAMGTMDPCR QYMMQTLGMGSSTAMFMSQPMALLQQQCCMQLQGMMPQCHCGTSCQMMQSMQQVICAG LGQQQMMKMAMQMPYMCNMAPVNFQLSSCGCC</aaseq>

Gene Sequence

<dnaseqindica>68..472#atcatcctcaacaatattgtctacaccatctggaatcttgtttaacactagtattgtagaatcagcaatggcagcatacaccagcaagatctttgccctgtttgccttaattgctctttctgcaagtgccactactgcaatcaccactatgcagtatttcccaccaacattagccatgggcaccatggatccgtgtaggcagtacatgatgcaaacgttgggcatgggtagctccacagccatgttcatgtcgcagccaatggcgctcctgcagcagcaatgttgcatgcagctacaaggcatgatgcctcagtgccactgtggcaccagttgccagatgatgcagagcatgcaacaagttatttgtgctggactcgggcagcagcagatgatgaagatggcgatgcagatgccatacatgtgcaacatggcccctgtcaacttccaactctcttcctgtggttgttgttgatcaaacgttggttacatgtactctagtaataaggtgttgcatactatcgtgtgcaaacactagaaataagaaccattgaataaaatatcaatcattttcaga</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0766100, RefSeq:Os03g0766100

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. 2.0 2.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  5. Cite error: Invalid <ref> tag; no text was provided for refs named ref5