Difference between revisions of "Os05g0158500"

From RiceWiki
Jump to: navigation, search
(References)
(Evolution)
Line 9: Line 9:
 
It finds that the levels of GS5 transcript varied drastically among tissues by comparison the temporal and spatial expression pattern of GS5 in two different species, which have different size of grain, using quantitative real-time PCR (qRT-PCR) with total RNA from 14 tissues. Studies also find that the transcript was much more abundant in plants whose grains are wide than those grains are narrow in the palea/lemma at 2, 4 and 5 d before heading, and in the endosperm at 10d after fertilization. These expression differences corresponded well with the critical stages for grain width and grain filling.
 
It finds that the levels of GS5 transcript varied drastically among tissues by comparison the temporal and spatial expression pattern of GS5 in two different species, which have different size of grain, using quantitative real-time PCR (qRT-PCR) with total RNA from 14 tissues. Studies also find that the transcript was much more abundant in plants whose grains are wide than those grains are narrow in the palea/lemma at 2, 4 and 5 d before heading, and in the endosperm at 10d after fertilization. These expression differences corresponded well with the critical stages for grain width and grain filling.
  
===Evolution===
+
===Location===
 
Using a double haploid (DH) population (92 lines) derived from a cross between Zhenshan 97 and H94 (both Oryza sativa L. ssp. indica), GS5 was detected in the interval between two molecular markers RM593 and RM574 on the short arm of chromosome 5.
 
Using a double haploid (DH) population (92 lines) derived from a cross between Zhenshan 97 and H94 (both Oryza sativa L. ssp. indica), GS5 was detected in the interval between two molecular markers RM593 and RM574 on the short arm of chromosome 5.
 +
[[File:Example.jpg|right|thumb|150px|''Locations of GS5 and qSW5/GW5 in the genetic map(from reference <ref name="ref2" />).'']]
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 07:26, 4 June 2014

Please input one-sentence summary here.

Annotated Information

This is a minor QTL for GW,also known as GS5. Forty-one SNPs and six InDels were detected in the 6.4-kb genomic region of GS5. Of these, 34 SNPs and three InDels were located in the promoter; two InDels were detected in the first exon, resulting in a change of two to five Glys. Three contiguous SNPs were located in the second exon, leading to two amino acid changes; a nonsynonymous SNP was detected in the ninth exon, and the remaining six SNPs were located in an intron and the 3’UTR.

Function

GS5 is a positive regulator of grain width,filling,and weight. It encodes a putative serine carboxypeptidase,which belongs to the peptidase S10 family.It functions putatively as a positive modulator upstream of cell cycle genes, and its overexpression can result in an increase in cell numbers by promoting mitotic division. Besides,it can increase cell size to some extent leading to enhanced latitudinal growth in the grain.

Expression

It finds that the levels of GS5 transcript varied drastically among tissues by comparison the temporal and spatial expression pattern of GS5 in two different species, which have different size of grain, using quantitative real-time PCR (qRT-PCR) with total RNA from 14 tissues. Studies also find that the transcript was much more abundant in plants whose grains are wide than those grains are narrow in the palea/lemma at 2, 4 and 5 d before heading, and in the endosperm at 10d after fertilization. These expression differences corresponded well with the critical stages for grain width and grain filling.

Location

Using a double haploid (DH) population (92 lines) derived from a cross between Zhenshan 97 and H94 (both Oryza sativa L. ssp. indica), GS5 was detected in the interval between two molecular markers RM593 and RM574 on the short arm of chromosome 5.

Locations of GS5 and qSW5/GW5 in the genetic map(from reference [1]).

Labs working on this gene

National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan, China.

References

[1]Lu L, Shao D, Qiu X, et al. Natural variation and artificial selection in four genes determine grain shape in rice[J]. New Phytologist, 2013, 200(4): 1269-1280.

[2]Li Y, Fan C, Xing Y, et al. Natural variation in GS5 plays an important role in regulating grain size and yield in rice[J]. Nature genetics, 2011, 43(12): 1266-1269.

Structured Information

Gene Name

Os05g0158500

Description

Peptidase S10, serine carboxypeptidase family protein

Version

NM_001061245.1 GI:115462220 GeneID:4337873

Length

4466 bp

Definition

Oryza sativa Japonica Group Os05g0158500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:3417351..3421816

Sequence Coding Region

3417558..3417704,3417799..3417904,3418132..3418227,3418328..3418476,3418562..3418834
,3419337..3419425,3420365..3420457,3420585..3420680,3420812..3420919
,3421359..3421650

Expression

GEO Profiles:Os05g0158500

Genome Context

<gbrowseImage1> name=NC_008398:3417351..3421816 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:3417351..3421816 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggtggcggcggcggcggcggcgaggcggcgagatgtctcttgtcttctcctcctcctgtgcttcagctcgtcaatggcggcgaccggcggcggcggcggcggcggcgagcaggaggctgacagggtggcgcggctcccggggcagccggcgagccccgccgtgtcgcagttcgccggctacgtcggcgtcgacgagcggcacggcagggcgctgttctactggttcttcgaggcgcaggcgtcgccggcgccggagaagaagccgctgctcctctggctcaatggaggacctggttgctcttccattggctatggtgctgcatcagagctagggcctctcagagttgcaagacaaggagcagcactagagttcaaccagtatggctggaacaaagaggctaacctcctgttcttggagtctcctgttggggtcggcttctcctacaccaacacatcctctgacctctccaatcttaatgatgattttgtagctgaggatgcttatagtttcctggtgaactggttcaagagatttcctcagtacaaggacaatgagttctacatctcaggggagagctatgcaggtcactatgtgccccaacttgctgaccttgtctatgagaggaacaaagacaaaagggccagcacatatatcaacctcaaggggttcattgtaggcaaccctctcaccgatgattactatgattcaaaaggtttggctgagtatgcctggagccatgcaattgtgtcggatcaagtttacgagcgcatcaagaaaacttgcaacttcaagaactccaactggactgacgattgcaatgctgcaatgaacataatcttcagtcagtacaatcagatagatatatacaacatttatgccccaaagtgccttctaaacagtacttcagcatcttcacctgatcgtgcattcttcgcaaataaccaggaacaattcaggtggagaatcaagatgttttcaggctatgatccatgctactcatcctatgctgaggactacttcaataagcatgatgtgcaagaagcattccatgcaaatgccagtggactgcttccagggaagtggcaagtttgcagtgaccaaatcctcaactcttacaatttctcagtactttccatcctacctatatactccaagctcatcaaagcagggctgagagtttggctctacagcggtgatgctgacggcagggtcccggttatcagttctcggtactgcgtggaagcactcggcctaccgatcaagaccgattggcaatcttggtaccttgacaagcaggttgctgggaggtttgtggagtaccatggaatgacaatggtgactgtcagaggggcaggtcacctggttcccctcaacaaacctgctgaagggcttatgctgataaatgcattccttcatggtgagaagcttccgacaagcagatga</cdnaseq>

Protein Sequence

<aaseq>MAVAAAAAARRRDVSCLLLLLCFSSSMAATGGGGGGGEQEADRV ARLPGQPASPAVSQFAGYVGVDERHGRALFYWFFEAQASPAPEKKPLLLWLNGGPGCS SIGYGAASELGPLRVARQGAALEFNQYGWNKEANLLFLESPVGVGFSYTNTSSDLSNL NDDFVAEDAYSFLVNWFKRFPQYKDNEFYISGESYAGHYVPQLADLVYERNKDKRAST YINLKGFIVGNPLTDDYYDSKGLAEYAWSHAIVSDQVYERIKKTCNFKNSNWTDDCNA AMNIIFSQYNQIDIYNIYAPKCLLNSTSASSPDRAFFANNQEQFRWRIKMFSGYDPCY SSYAEDYFNKHDVQEAFHANASGLLPGKWQVCSDQILNSYNFSVLSILPIYSKLIKAG LRVWLYSGDADGRVPVISSRYCVEALGLPIKTDWQSWYLDKQVAGRFVEYHGMTMVTV RGAGHLVPLNKPAEGLMLINAFLHGEKLPTSR</aaseq>

Gene Sequence

<dnaseqindica>4113..4259#3913..4018#3590..3685#3341..3489#2983..3255#2392..2480#1360..1452#1137..1232#898..1005#167..458#aagaacaccaaacgagaagctccaagctcgcaataattcaccaagaatcgcaccacttttcaccttttcttctcctcctccatttccatccatggcgacgctgctgctgctgctgcacacggcgcaacagtgagctatagctagagctcggcaccacgggttagcaatggcggtggcggcggcggcggcggcgaggcggcgagatgtctcttgtcttctcctcctcctgtgcttcagctcgtcaatggcggcgaccggcggcggcggcggcggcggcgagcaggaggctgacagggtggcgcggctcccggggcagccggcgagccccgccgtgtcgcagttcgccggctacgtcggcgtcgacgagcggcacggcagggcgctgttctactggttcttcgaggcgcaggcgtcgccggcgccggagaagaagccgctgctcctctggctcaatggaggtctcgatcgcttctgctttttttttttctaaaaaaaaagaatttgctgcagtaaaagctctgttaaatgttaatcggttaaaaattctgttagttaagtaagtaattactcctagtaaaaactacagtttctgtttgttcttttgtgtgtgcgatatgaaaaattcagatattttctcttgggtatttgttctgtggagtacttgtcgtttatgtttgtttagttttgagatgaggtttcaggttaaatttgtgatcattggttaatctgaacttctgaagagctgcttattgattttttttctttcaactgatcatattgcataaatataaataaataaatgattgttgcatgcaacatttatgttctttcttgatggttaattaggaatatttttttttctaaatggtttgttaattttgttcttggttttgtcaggacctggttgctcttccattggctatggtgctgcatcagagctagggcctctcagagttgcaagacaaggagcagcactagagttcaaccagtatggctggaacaaaggtgcagagtttattttgtttcctttaattcctgaattatttaaatatttttcatgcttaacatcactgacatttgtctttagtataattctgaaaacattttttttgtgctataaaattggtctttgccagaggctaacctcctgttcttggagtctcctgttggggtcggcttctcctacaccaacacatcctctgacctctccaatcttaatgatgattttgtaggtaattaagctgattgtaaaatgatactctagtttgcttggccatctacaggtgatctgaatttcgattgccttgtaataatgattagaagtgtaattttgtggcatcctttttttttttgttgcagctgaggatgcttatagtttcctggtgaactggttcaagagatttcctcagtacaaggacaatgagttctacatctcaggggagagctatgcaggtaaactcatttcagaaatgaaaccggtaaattttctaatcagttttgtatggtctaacattcagaattcttcattttcatcaagaaattaaaagatttcctaaccgcaacatattacaaaatctggtgtgagacatttttctcatttgttctcatgtggatgtaaacatgtccaagatgccttcctttcaagattccagttatctaatcaaaatggaaggcagcatcccaatccttgaccaaaattttcttatcgtttgctttcacaatatctcaaggattgtatgtatcgaattatgttagtgtcaccatcttatctgaaaccagaacttccactgaagaaaaaaatcatcactgactttatagaactagctgacacctatcatgagttcatgacagctcttagttcagcaatcatccccttagcaagcaaacaaaagatcatacttttaatggtgaaagtgtcagatcaggaaccaagtctctaaaataatataaggtttagtttcagccttctcaaatattcctgaagtacaatattctcagagtcatctgattgttcagaattcagaagaaatttatgtagaattcagtaaaagatgacctgcttaaacaaaaggtagaatgatttcagttgttacttgcatttatgtattgaggacagaaattataccgatgccatccgaactgatagattttctctgcttgaaacaaagtttgagtttttggattgtaatattggtccattagatctctgaacatatgtccctgaaagaatgaccaaagcatcagtggtaggttcacgggctacattgggcttctttcacaatccacatgctgtggaccagaagatgctctgcaaaaaaagcttttgttctgcacatcatgcaagatgaatctcaatctgaacttttcctgtgcaatgtccctgttatacaggtcactatgtgccccaacttgctgaccttgtctatgagaggaacaaagacaaaagggccagcacatatatcaacctcaaggggttcattgtgagaatttcttgaattgctttcagtaattattgttatggttttgccaaaaagttcttttatgtgaaatgtgctcatgtataagaaaccatatacaaacttagaaagtagaaagaactgtttactctcaccgtttcatattgcttgtcattttagctttgtcttaagtcaaacattccttacaacttacgccataaacttttactcataagatttatgtttttagattgaacaaaagaaatactttcataatatataattcacatgttcttaaactatatgaatttacagaaattgatggtcaaagttaggtatattcgacttaggacaaaactaaaacgacaagtaatttgaaacggagggagtattttgaacaatagtttctcagttgtaatgctcacaggaacacccaattggaacacgattaacttccatttaaaccatcctaaactcataaaattggttcctgcatgaacataacagtcaaaaaatctgcttgcaggtaggcaaccctctcaccgatgattactatgattcaaaaggtttggctgagtatgcctggagccatgcaattgtgtcggatcaagtttacgagcgcatcaagaaaacttgcaacttcaagaactccaactggactgacgattgcaatgctgcaatgaacataatcttcagtcagtacaatcagatagatatatacaacatttatgccccaaagtgccttctaaacagtacttcagcatcttcacctgatcgtgcattcttcgcaaataaccaggtaaaactgatccatatgcaaaaaaaaggataaagtttcattctggaccctcttctgaaattcatgcatttctgtgttttgacaggaacaattcaggtggagaatcaagatgttttcaggctatgatccatgctactcatcctatgctgaggactacttcaataagcatgatgtgcaagaagcattccatgcaaatgccagtggactgcttccagggaagtggcaagtttgcaggtgaattagcccaaagatttttcagttttatatttcaatgtattagccattaattcttttagcttgacaggaagctgagctcatccatttctttttgcagtgaccaaatcctcaactcttacaatttctcagtactttccatcctacctatatactccaagctcatcaaagcagggctgagagtttggctctacaggtttgcctcatcttaatcttagacctgttcaattaaatccatttttcagttttttttatcattcacctcagatcttccccattatcctccatactacagttcttgtacagtttctctgaaaccttgaaattactgttcaaatatattggtagtaatatgcatctacataaaaaatatgcaacaatgccctacaatttacctgaatcagtctctgttcatcaaagcagcggtgatgctgacggcagggtcccggttatcagttctcggtactgcgtggaagcactcggcctaccgatcaagaccgattggcaatcttggtaccttgacaagcaggtctgcaaaccagaagctgaactgaacatcaatacatcatgtgatttgacttgtatacatgctgaaacatggagcaaaatatttcaatttgcaggttgctgggaggtttgtggagtaccatggaatgacaatggtgactgtcagaggggcaggtcacctggttcccctcaacaaacctgctgaagggcttatgctgataaatgcattccttcatggtgagaagcttccgacaagcagatgatatgcgctgctgatgaagctttggaggtacaagatggcatgagatacaggcatggacatcaattttcattgaaaggcgccaatcggatagatttgatatggtagtatccaaatcaatttcaagtgcgccgtaaattcagtactctgttgaacattcttttaaatctgttgttgactatgactttcttcttttgtgttttttttactc</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0158500, RefSeq:Os05g0158500

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref2