Difference between revisions of "Os03g0103300"
(→Function) |
(→Function) |
||
| Line 6: | Line 6: | ||
controlling low-temperature germinability in the rice variety Italica Livorno. Its expression is tightly associated with vacuolation of the tissues covering the embryo. This may cause tissue weakening, resulting in reduction of the mechanical resistance to the growth potential of the coleoptile. The research phenomena are quite similar to the model system of seed germination presented by dicot plants, suggesting that this model may be conserved in both dicot and monocot plants.[1] | controlling low-temperature germinability in the rice variety Italica Livorno. Its expression is tightly associated with vacuolation of the tissues covering the embryo. This may cause tissue weakening, resulting in reduction of the mechanical resistance to the growth potential of the coleoptile. The research phenomena are quite similar to the model system of seed germination presented by dicot plants, suggesting that this model may be conserved in both dicot and monocot plants.[1] | ||
| − | Based on the results of Genome-wide analysis, a hypothetical model of the role of ''qLTG3-1'' in seed germination is proposed. ''qLTG3-1'' has a role in the up-regulation of genes involved in phytoalexin biosynthesis and ''PBZ1'', which are inducible by elicitors and UV. It is currently unclear whether qLTG3-1 up-regulates these genes mediated by elicitors in this model. Momilactones A, ''PBZ1'', and ''PBZ1''-inducible genes of a putative phenylalanine ammonia-lyase (''PAL'') and ''COMT'', might induce PCD. Therefore, ''qLTG3-1'' may enhance seed germination by weakening the tissues covering the embryo under several stress conditions.[2] ( | + | Based on the results of Genome-wide analysis, a hypothetical model of the role of ''qLTG3-1'' in seed germination is proposed. ''qLTG3-1'' has a role in the up-regulation of genes involved in phytoalexin biosynthesis and ''PBZ1'', which are inducible by elicitors and UV. It is currently unclear whether qLTG3-1 up-regulates these genes mediated by elicitors in this model. Momilactones A, ''PBZ1'', and ''PBZ1''-inducible genes of a putative phenylalanine ammonia-lyase (''PAL'') and ''COMT'', might induce PCD. Therefore, ''qLTG3-1'' may enhance seed germination by weakening the tissues covering the embryo under several stress conditions.[2] (Figure 1.<nowiki>Insert non-formatted text here</nowiki>) |
===Gene and Protein structure=== | ===Gene and Protein structure=== | ||
Revision as of 08:26, 4 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
qLTG3–1 ,a quantitative trait locus for low-temperature germinability on chromosome 3, has been identified as the most effective locus controlling low-temperature germinability in the rice variety Italica Livorno. Its expression is tightly associated with vacuolation of the tissues covering the embryo. This may cause tissue weakening, resulting in reduction of the mechanical resistance to the growth potential of the coleoptile. The research phenomena are quite similar to the model system of seed germination presented by dicot plants, suggesting that this model may be conserved in both dicot and monocot plants.[1]
Based on the results of Genome-wide analysis, a hypothetical model of the role of qLTG3-1 in seed germination is proposed. qLTG3-1 has a role in the up-regulation of genes involved in phytoalexin biosynthesis and PBZ1, which are inducible by elicitors and UV. It is currently unclear whether qLTG3-1 up-regulates these genes mediated by elicitors in this model. Momilactones A, PBZ1, and PBZ1-inducible genes of a putative phenylalanine ammonia-lyase (PAL) and COMT, might induce PCD. Therefore, qLTG3-1 may enhance seed germination by weakening the tissues covering the embryo under several stress conditions.[2] (Figure 1.Insert non-formatted text here)
Gene and Protein structure
Please input expression information here.
Expression
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os03g0103300 |
|---|---|
| Description |
Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein |
| Version |
NM_001055203.2 GI:297600190 GeneID:4331303 |
| Length |
941 bp |
| Definition |
Oryza sativa Japonica Group Os03g0103300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:198326..199266 |
| Sequence Coding Region |
198414..198968 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:198326..199266 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:198326..199266 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgacgaaagctggggtgatcgccacgctcctggccctgaacctccacttcttcaccttctccgacgcgtgcggctgccagtgcggctcatgccctagtcccggcggaggaggcggtggcggtggcggtggcggtggcggtggtggagggcgtggaggtggtggcgggagcggcggaggttcaggtggaggcggcggttcaggtggaggaggaagcggcggcggaggttcaggcggtggaggaagcggaggcggcggaggaggaggaagcggcggcggcgggggaggaggaagatgcccgatcgacacgctgaagctgggggtgtgcgcgaacgtgctgaatgggctgataaacgtgcagctggggacgccgccgcggcagccgtgttgcagcctcatccagggcctcgccgaccttgaggccgccgtgtgcctctgcaccgccctccgcgccaacatccttggcatcaacctcaacctccccatcaacctcagcctcctcgtcaactactgcggccgctccgtcccctccggcttccagtgcagcaactaa</cdnaseq> |
| Protein Sequence |
<aaseq>MATKAGVIATLLALNLHFFTFSDACGCQCGSCPSPGGGGGGGGG GGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGGGGGRCPI DTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLN LPINLSLLVNYCGRSVPSGFQCSN</aaseq> |
| Gene Sequence |
<dnaseqindica>89..643#atctgaatacactggctagcaagcaaagctaggtagaggccaggccatagatcgagatcgatctgcaggtgcagtgcggtgggtgggcatggcgacgaaagctggggtgatcgccacgctcctggccctgaacctccacttcttcaccttctccgacgcgtgcggctgccagtgcggctcatgccctagtcccggcggaggaggcggtggcggtggcggtggcggtggcggtggtggagggcgtggaggtggtggcgggagcggcggaggttcaggtggaggcggcggttcaggtggaggaggaagcggcggcggaggttcaggcggtggaggaagcggaggcggcggaggaggaggaagcggcggcggcgggggaggaggaagatgcccgatcgacacgctgaagctgggggtgtgcgcgaacgtgctgaatgggctgataaacgtgcagctggggacgccgccgcggcagccgtgttgcagcctcatccagggcctcgccgaccttgaggccgccgtgtgcctctgcaccgccctccgcgccaacatccttggcatcaacctcaacctccccatcaacctcagcctcctcgtcaactactgcggccgctccgtcccctccggcttccagtgcagcaactaatatagctgctgctccattctacttcactgcttgctacacacaagaacgtacgaagaacgaccaccaggccacgtacaactatatatctatctatgtctaatttgttccttgttcaaatcatcatatgtatctgcgtgccttaatttcctccttcatcccgtaaattaatgagatatatatgcatgcatatgattcagttccacgacgtaattaaagcatgcttcattcgtctacttgtatatgtgtatctgcataattgattaattaatttgtactcgatggatctcatcgtatatgc</dnaseqindica> |
| External Link(s) |