Difference between revisions of "Os11g0116200"

From RiceWiki
Jump to: navigation, search
(Research arctiles)
(Annotated Information)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
 +
one gene of Lipid transfer proteins (LTPs)
 +
also one gene of Non-specific lipid-transfer protein
 +
 +
==Function==
 +
 
Gene Os11g0116200 is one gene of Lipid transfer proteins (LTPs).while Lipid transfer proteins (LTPs) are highly conserved proteins in plants and play an important role in the resistance to pests, activation of resistance signalling, and adaptation to environmental stress.therefore,this gene palys a important role in pesticide-induced susceptibility.the other Lipid transfer proteins (LTPs) genes are Os012g0115100, Os10g0551700, Os10g0552600, Os11g0427800, Os12g0114800, Os11g0115100Os01g0822900, Os12g0114500.
 
Gene Os11g0116200 is one gene of Lipid transfer proteins (LTPs).while Lipid transfer proteins (LTPs) are highly conserved proteins in plants and play an important role in the resistance to pests, activation of resistance signalling, and adaptation to environmental stress.therefore,this gene palys a important role in pesticide-induced susceptibility.the other Lipid transfer proteins (LTPs) genes are Os012g0115100, Os10g0551700, Os10g0552600, Os11g0427800, Os12g0114800, Os11g0115100Os01g0822900, Os12g0114500.
 +
 
According to NCBI, gene Os11g0116200 is also a gene of Non-specific lipid-transfer protein.the function is Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
 
According to NCBI, gene Os11g0116200 is also a gene of Non-specific lipid-transfer protein.the function is Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
  

Revision as of 11:23, 4 June 2014

Please input one-sentence summary here.

Annotated Information

one gene of Lipid transfer proteins (LTPs)
also one gene of Non-specific lipid-transfer protein

Function

Gene Os11g0116200 is one gene of Lipid transfer proteins (LTPs).while Lipid transfer proteins (LTPs) are highly conserved proteins in plants and play an important role in the resistance to pests, activation of resistance signalling, and adaptation to environmental stress.therefore,this gene palys a important role in pesticide-induced susceptibility.the other Lipid transfer proteins (LTPs) genes are Os012g0115100, Os10g0551700, Os10g0552600, Os11g0427800, Os12g0114800, Os11g0115100Os01g0822900, Os12g0114500.

According to NCBI, gene Os11g0116200 is also a gene of Non-specific lipid-transfer protein.the function is Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

Laboratory

1.School of Plant Protection, Yangzhou University, Yangzhou 220059, PR China

2.Microbiology and Immunology Department, Georgetown University, Suite 603, 2115 Wisconsin Ave, NW, Washington, DC 2007, USA

Research arctiles

Yao Cheng,a Zhao-Peng Shi,a Li-Ben Jiang et al.Possible connection between imidacloprid-induced changes in rice gene transcription profiles and susceptibility to the brown plant hopper Nilaparvatalugens Stål (Hemiptera: Delphacidae)[J].Pesticide Biochemistry and Physiology.2012.

International rice genome sequencing project (IRGSP).The map-based sequence of the rice genome.Nature 2005

The rice annotation project (RAP).The rice annotation project database (RAP-DB): 2008 update.

Structured Information

Gene Name

Os11g0116200

Description

Similar to Nonspecific lipid-transfer protein 1 (LTP 1) (Major allergen Pru d 3)

Version

NM_001072118.2 GI:297611104 GeneID:4349606

Length

3991 bp

Definition

Oryza sativa Japonica Group Os11g0116200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:721983..725973

Sequence Coding Region

722065..722411,725207..725258

Expression

GEO Profiles:Os11g0116200

Genome Context

<gbrowseImage1> name=NC_008404:721983..725973 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:721983..725973 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctgcagttaactgcaaggtggtggtcgccgtgattgtggtggcgatggtggttgcggcgccgggggcgtcggcggcgataacgtgcgggcaggtgggatcggcgatcgcgccgtgcatctcgtacgtgacggggaggagcggcctcacgcagggatgctgcaacggagtgaaggggctgaacaacgccgcccgcaccaccgccgaccgccaggcggcctgccgctgcctcaagagcctcgccggcagcatcaagtcgctcaacctcggcaccgtcgccggcgtccccggcaagtgcggcgtcaacgtcggcttccccatcagcctctccaccgactgcaacaaccagccatgcggcggctgggtgacgtcgtggaggcgcctgcgctggtgctga</cdnaseq>

Protein Sequence

<aaseq>MAAVNCKVVVAVIVVAMVVAAPGASAAITCGQVGSAIAPCISYV TGRSGLTQGCCNGVKGLNNAARTTADRQAACRCLKSLAGSIKSLNLGTVAGVPGKCGV NVGFPISLSTDCNNQPCGGWVTSWRRLRWC</aaseq>

Gene Sequence

<dnaseqindica>83..429#3225..3276#atcaccggcgacgaggagacactcactgatataatcaagctagctagcttaatcacctagctatccgtcagtttagctagatatggctgcagttaactgcaaggtggtggtcgccgtgattgtggtggcgatggtggttgcggcgccgggggcgtcggcggcgataacgtgcgggcaggtgggatcggcgatcgcgccgtgcatctcgtacgtgacggggaggagcggcctcacgcagggatgctgcaacggagtgaaggggctgaacaacgccgcccgcaccaccgccgaccgccaggcggcctgccgctgcctcaagagcctcgccggcagcatcaagtcgctcaacctcggcaccgtcgccggcgtccccggcaagtgcggcgtcaacgtcggcttccccatcagcctctccaccgactgcaacaagtatatcatctctctatgactcctctctctctctctatatatatatatacacgcatatatctctttattttttacgtgctatctaaatactccctccgtttcaggttataagacgttttaactttggttaaagttaaacttctctaagtttaactaattctgtagaaaaaagtaataatatttaaataccatcatagtttcattaaatccataattgaataaattttcataatatatttgtcatgggttaaaaaagatactacttttttactacaaaatcagtaaaacttacagtattttaactttaaccaaagtcaaaacgtcttataatctaaaatggagcaatagttaataaaaacttttacaagttaagatagattaccatatgtgagatatatctcacttcatagacataaaagattaaattcaacttatacaagttaaattaaaaaacaaactaaactaacactagttaacgtattttcgctattatatctgttattattgttacaacttgtacaagtttaatttaaacatgtatatttatggacatgcatatttaatattaatctatcttatcattttgttttactttttaatggctattaaggtggggggatgaaagcaacaatgagatatttctcgagatatgaaacattttcccataaaataactacctatatatatgcattttttttctttggtgcagggtcagctagatcaattaatcctgcttggatcgatcgatcgagcttaacacgctagctcgatcggagttgatcagctagtaattaagcacgtatttgctacagcatatatgaacaaagtaattaaaataacacctgcggcagacatgcagcgctccattctctctctgtatcagctgtatactttatgttgcacgctccctgtgtgcatgttctatcttaattttcttcagtatgtacacgatctgtgtgtactacgtgtaatcctatacgttttatgaattgcatgttgtccaaatgtctttgtcctagctactagctactccagcttcttgctgaggaaatctgcagtagtagtaatccctcgttgtgatacgcaacaaaattgtttaatgtgatcctgctatatatatagaaaatcatctctattattttacaggcataaaacaagtccactctaaaaacaattagtgcggccgttgtcttaatagacccgtatgtgaaaatcgtttttcacaagcagttccttaagacaacttcatgtatcattattgtagtatgtcaaaaagatgcaccacactatgcacagtcatacaaaatggcactactacacaactgatcttttatcgggatatccatttcggatagatttagaacgggtattagagatatttttaagcaccggttaccaaaaacatctttaattccgattggtgttataaccggtactaaagatgcctacagggctagtttaaaaagaaaacatccatatccatgtctgatgggtggagttggtggatggttacacgcgtgagggctgaggtgagagatcttgagttcgaatcacatatcccacacattttttttatttcgtatgcatctttagtaccggttatttcaactggtactaaagatcgagatatttagtctcgatttgttagaaccggttctacatctaaaacggttcccaactggtgctaaaaatgggttctccactagtgtggcaatacatttacattcacacattaaggattcacatcgtcacccatattcacgttgacactgtcttttaatgtataatttaaatgttcacattgtgaatattcgacaatgatagggagcccgatccctatctacaagtctaaacctaagattaatttgatcgacatgagctaatgaatagataagcgcactatctattgcttgaaatggtagatccattaatttccttttcatatatagattattgtaaaaagttgtcgttggctgattggaaatagacttgggcatgaaacctataccctctgcaactccacgtaatcgaaaatcatcctggaatagacccaaggatgaaatttagaccaaggaacgaaattgggcatctataagtgtggggagacaaaaataaacggtttcatagagttaaatgatcaaagttggaacaatattgcaatagttgatgattaaattaattaatgtggacttctttaaaccatatatagactgtgttcggcagcgctgttcctaacactaccagtacgcacgaaaaatgaaacggtccattagcgcgtgattaattaagtattagctattttttttaaaaaaaatgaattaatttgattttttttcaaacaactttcgtatagaaactttttaaaaaaacacaccgtttagcagtttcaaaagcgtgcgcacgaaaaacaagggaggagggttgagaaaaagggtgccgaagtattgtgcgctagatactggtaggggcattgttgtccatcctcggaagtggctcaaatataacgtgccacgacattagcgccatttcttacacgaaaacgaaacagggaaaactaattgaacaaatagagagatatgtagctagctagctttcagagtccactttttgagagagctcaatccaatgtgtggtttggctgcagcgacgaaccagaataatctcactctgctggtgcacccaatcaccaaatccaaaggaaattcaatgtacaacaaaattaaaaagaacatcttataatttgtctcctcctcctgcatatgcttgactcctagcttaactagaggtacctgcagccagccatgcggcggctgggtgacgtcgtggaggcgcctgcgctggtgctgacgccggcctccatgcagcaggccggcgggagggggagctccggcgccttggacgccagcatggtcgtcatcctcgccgcgctgctctgcgtcgtcatctgcgccctcggcctcacctccctcatccgctgcgcgctccactgcgcccgcggcctctcccccaccacggcgacgccgacgccgtcggtgtcgacagctgccacggccgggctgaagaagacggagctgaggaggattccggtggaggtgtacggcgccaagcaggccggcgtccccgacggcgagtgcgccatctgcctgggcgacttcgccgacggcgacaaggtgcgcgtgctcccgaggtgccaccacggcttccacgtccgctgcatcgacacgtggctcgccgcgcacacgtcctgccctacttgccgggactccattctctccgtccatggagtcgtcgccggcggccaaacatagctagtaatataatttcttgaacagaagaggtctaaaatgtaaatagaatataggtggtaaagtactccaaaattgggattgcgtaaatgcaagggattggacacaatgtttgaagtgtctctgtcacttggattatccatctgtttagctgtttctatgagttttctcctttaatttgtgtgctagcacatgatatttcccccaagattcgctgttcgtttgttctgggcataattttgtcaccactcaacaac</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0116200, RefSeq:Os11g0116200