Difference between revisions of "Os10g0577600"

From RiceWiki
Jump to: navigation, search
(Localization)
(Evolution)
Line 12: Line 12:
 
A genomic survey revealed 20 and 21 jmjC domain-containing genes in rice and Arabidopsis, respectively (Fig. 1). The sequence alignment
 
A genomic survey revealed 20 and 21 jmjC domain-containing genes in rice and Arabidopsis, respectively (Fig. 1). The sequence alignment
 
resulted in the discrimination of five groups containing the plant proteins. Groups I, II, and IV were found to be related to the JARID, JMJD2, and JHDM2 subfamilies, respectively (12). Group V could be divided into several subgroups, each of which was found to have related members of the human 'JmjC domain-only' subfamily (12).
 
resulted in the discrimination of five groups containing the plant proteins. Groups I, II, and IV were found to be related to the JARID, JMJD2, and JHDM2 subfamilies, respectively (12). Group V could be divided into several subgroups, each of which was found to have related members of the human 'JmjC domain-only' subfamily (12).
 +
 +
[[File:Phylogenetic.jpg]]
  
 
===Localization===
 
===Localization===

Revision as of 12:16, 4 June 2014

Please input one-sentence summary here.

Annotated Information

Function

JMJ706 encodes a heterochromatin-associated H3K9 demethylase involved in the regulation of flower development in rice. Histone lysine ethylation is an important epigenetic modification with both activating and repressive roles in gene expression. Jumonji C (jmjC) domain-containing proteins have been shown to reverse histone methylation in non plant model systems. Here, we show that plant Jumonji C proteins have both conserved and specific features compared with mammalian homologues. In particular, the rice JMJD2 family jmjC gene JMJ706 is shown to encode a heterochromatin-enriched protein. The JMJ706 protein specifically reverses di- and trimethylations of lysine 9 of histone H3 (H3K9) in vitro. Loss-of-function mutations of the gene lead to increased di- and trimethylations of H3K9 and affect the spikelet development, including altered floral morphology and organ number. Gene expression and histone modification analysis indicates that JMJ706 regulates a ubset of flower development regulatory genes.

Expression

Evolution

A genomic survey revealed 20 and 21 jmjC domain-containing genes in rice and Arabidopsis, respectively (Fig. 1). The sequence alignment resulted in the discrimination of five groups containing the plant proteins. Groups I, II, and IV were found to be related to the JARID, JMJD2, and JHDM2 subfamilies, respectively (12). Group V could be divided into several subgroups, each of which was found to have related members of the human 'JmjC domain-only' subfamily (12).

Phylogenetic.jpg

Localization

JMJ706 is enriched in heterochromatin domains. To study JMJ706 localization in rice nuclei, a construct expressing a JMJ706 fusion with the GFP was used to transform WT rice plants. Nuclei of the transgenic leaf mesophyll cells showed an enrichment of the fusion protein in spots that overlapped with 4,6-diamidino-2-phenylindole (DAPI)–stained regions (Fig. 2B). To confirm this result, a construct expressing FLAG-tagged JMJ706 protein was used to complement JMJ706 T-DNA insertion mutant lines . The FLAG-tagged protein was also observed in enriched DAPI-stained domains (Fig. 2C).

Sublocalization.jpg

Mutant

JMJ706 Loss-of-Function Mutation Affects Floral Organogenesis. A search of a database of a rice T-DNA insertion library identified two insertion lines of the JMJ706 gene (Fig. 4A).Characterization of the insertion mutants revealed similar spikelet morphology defects (Fig. 4B).The phenotype cosegregated with the homozygous state of the insertions and the absence of JMJ706 mRNA accumulation (Fig. 4C).The mutant spikelets showed a variety of defects, mainly on floral organ number (Fig. 4 D–H). Some spikelets were depleted of lemma and/or palea (Fig. 4D), whereas others had an additional piece of palea (Fig. 4E). Increased numbers of stamens and pistils were also observed (Fig. 4F). In addition, vitrified tissues were seen in some spikelets (Fig. 4G). Scanning microscopy revealed irregular cell size and arrangement on the mutant palea surface with increased bristle numbers (Fig. 4H). Some spikelets could still produce seeds. These mutant seeds had a deformed shape, but they germinated and produced normal seedlings, suggesting that embryogenesis was not affected. Mutant.jpg

Labs working on this gene

Dao-Xiu Zhou, Institut de Biotechnologie des Plantes, Universite´ Paris Sud 11, 91405 Orsay, France

References

Please input cited references here.

Structured Information

Gene Name

Os10g0577600

Description

Similar to PLU-1 protein

Version

NM_001072024.1 GI:115483643 GeneID:4349499

Length

5887 bp

Definition

Oryza sativa Japonica Group Os10g0577600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:23481090..23486976

Sequence Coding Region

23482626..23483016,23483139..23483295,23483373..23483592,23483708..23483761,23483848..23483927
,23484014..23484291,23484373..23484774,23484848..23485170,23485245..23485508
,23486108..23486515

Expression

GEO Profiles:Os10g0577600

Genome Context

<gbrowseImage1> name=NC_008403:23481090..23486976 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:23481090..23486976 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcaacaggtggagggcaggaactgtcttcctgcggaggtcaggattggcctcgagacgctcaagaggcgccggcttgagaggatgcgtttgactgctcagaacaatgccggcgacggtcctccggtgcccgcaaggagcggtggggatgcgctaaggactcccgcaaactgcggggtcaggttgcatgctaacaatggcacagctctacctagcagaaccacccagaacaaggacccttttgcaaagcgcagggtggacaagtttgatatgtctagcctagaatggattgacaagatcgaagaatgccctgtgtactatcctaccaaggaggagttcgaggatcccattggttatatacagaagattgcacctgtggcttcgaaatacggaatttgcaaaatcgtatctccagtaagcgcttctgttcctgctggtgtcgtgttgatgaaggaacagcctggtttcaagttcatgaccagggttcagccgcttcgcctcgccaaatgggctgaagatgacacggtcactttcttcatgagcgaaagaaagtacactttccgggattatgagaaaatggccaacaaggtgttcgccaagaaatactcaagtgctagttgtctcccagctaagtacgtggaggaggaattctggcgcgaaattgcttttggtaaaatggattttgttgaatatgcctgtgatgttgatggtagtgctttctcctcttctcctcatgatcaacttgggaaaagcaactggaacttgaagaatttttcacggctttccaattctgtgcttagacttctgcagacaccaattccaggagtaacagatccaatgctttatatcgggatgctcttcagcatgtttgcttggcatgtggaagatcattatttgtacagcatcaattaccatcattgtggggcatttaagacatggtatggcataccgggtgatgctgctcctgggtttgaaaaggtggctagccagtttgtatacaacaaggatattttggttggtgaaggagaggatgcagcatttgatgttctcttggggaagacaacaatgttccccccaaatgtcttgttagaccacaacgttcctgtttataaagctgtgcaaaaacctggggagtttgtcattactttccctcgttcctaccacgcgggtttcagccacggcttcaattgtggcgaggctgtcaactttgctatcagtgactggtttcctctgggttctgtggccagcagacgctacgcgcttctgaacagaacacccttgcttgcacacgaggagttactttgccgttctgcagtgcttctgtcccacaaactgttaaacagcgacccaaaatccctcaataaatctgagcatccacattcacagcgttgtttgaagtcttgctttgtgcagttgatgcgattccagagaaacacacgtggcctacttgctaaaatgggctctcagatacattataagccaaaaacatacccgaatctctcatgtagcatgtgtcggcgtgattgctacattacacatgtgttgtgtggatgcaactttgacccagtctgtcttcatcacgaacaagaactccggagctgcccttgtaaatctaaccaggttgtctacgttagggaggacatacaggagctagaagctctatcaagaaaatttgagaaggatatttgcttggataaggaaataagtggttttgactcatacaagcaggccgaaaagaatgagccattttttgagataactcggaacctcaggaacactgaagtaaatttgatagaggatgccttctcaggagcaactgctgctgatgctgcaaagagttctcctgcaacgtcaacactgacatcttttgcacaacatgatgtgcctgttcttgctgaagcaattgtctgtgctaatcaagccgaccaattatactccaccaccgagcaaaccatcagctcacctttagtcaaaggaactgatgctgtgggtgcaaattcatccagcatggctgatgctaataacggaactggttcttgtaatgcttcagctgtggaatacagtggaaattcagattctgaatctgaaatatttcgagtcaagcgcaggtctggcgtatcagtaaagcctgcatctgatgccaagacatcaaacttgtctgatcaacaggttctcaggcggttgaagaaggtgcgccctgaaatacaacagcacaataagcgaccagaagactatggtcactgttcagttccctcaggtcgtatgagtatgaagaatttgaattcatcctcctcatgtggtgaagaacactggaggatgaagcggcggcagttggagactcagcaggatgagagcagttattctgcaaagcagaagtcgtactcgtatccatccaccagctattctttccgaggagagtttgtggaaatgagtagagatgctgctgcagaagtccgaccaaagcgactgaaaatccggctaccttcttctagcacgaacagagtggttgagcagggcagttcagggcaaagatttacaagggatgacaagtcgcttggttgttggcctgcaatttag</cdnaseq>

Protein Sequence

<aaseq>MQQVEGRNCLPAEVRIGLETLKRRRLERMRLTAQNNAGDGPPVP ARSGGDALRTPANCGVRLHANNGTALPSRTTQNKDPFAKRRVDKFDMSSLEWIDKIEE CPVYYPTKEEFEDPIGYIQKIAPVASKYGICKIVSPVSASVPAGVVLMKEQPGFKFMT RVQPLRLAKWAEDDTVTFFMSERKYTFRDYEKMANKVFAKKYSSASCLPAKYVEEEFW REIAFGKMDFVEYACDVDGSAFSSSPHDQLGKSNWNLKNFSRLSNSVLRLLQTPIPGV TDPMLYIGMLFSMFAWHVEDHYLYSINYHHCGAFKTWYGIPGDAAPGFEKVASQFVYN KDILVGEGEDAAFDVLLGKTTMFPPNVLLDHNVPVYKAVQKPGEFVITFPRSYHAGFS HGFNCGEAVNFAISDWFPLGSVASRRYALLNRTPLLAHEELLCRSAVLLSHKLLNSDP KSLNKSEHPHSQRCLKSCFVQLMRFQRNTRGLLAKMGSQIHYKPKTYPNLSCSMCRRD CYITHVLCGCNFDPVCLHHEQELRSCPCKSNQVVYVREDIQELEALSRKFEKDICLDK EISGFDSYKQAEKNEPFFEITRNLRNTEVNLIEDAFSGATAADAAKSSPATSTLTSFA QHDVPVLAEAIVCANQADQLYSTTEQTISSPLVKGTDAVGANSSSMADANNGTGSCNA SAVEYSGNSDSESEIFRVKRRSGVSVKPASDAKTSNLSDQQVLRRLKKVRPEIQQHNK RPEDYGHCSVPSGRMSMKNLNSSSSCGEEHWRMKRRQLETQQDESSYSAKQKSYSYPS TSYSFRGEFVEMSRDAAAEVRPKRLKIRLPSSSTNRVVEQGSSGQRFTRDDKSLGCWP AI</aaseq>

Gene Sequence

<dnaseqindica>1537..1927#2050..2206#2284..2503#2619..2672#2759..2838#2925..3202#3284..3685#3759..4081#4156..4419#5019..5426#ctctttcctcctccgccgcccgcccgcccattgccgagctccccgccgcacgccccagctaactaccactccggcacggcagggcagggcagggctcgccgccggaggggaatgtggcatccttaccttccccccttgccgtaaaacaaagaaagaaagtctcccgtctcggctccttgcgccatcgtcgacaggggaggggaggtggcgagcagtagcaggggaggggatcctccaggtgaccatcctctttctcacaaattcttctctctcccaccgggactacaatttgcttgcgttccttaatttcgcaccctcttttagatctggtgcaagaagctcttctcctccttaatttcgcaccctcctttaccgcaatactacaatctagtttgttgtctgttcccccccatccaatttaccctagattcctcatcaaatcacaccattttccctcaccctcctcagccccacggattaccgccttctttttcttactactaattgccgtccgtccgttgatgtttggaaaaagtaccacttttcttcttccttaatcttaatttgacgacgacgcgtagaggagaggaggtacagaaccaccggtatctaatcaaacagagacaagaaagttggaatcctaatttggccccgggtcgctgcaacagaatgcaagactagattgacacctagatttaccttaccttagaccgggccacaagtcaacgcgctcaattcatttcatttaccaccacaccactagtcgttcctccatcctggagtactactgtagtaggagtagtttttagtattcattactctctgtatggatgggatattactactactgtagtagagtagtcaagaggcggtcttccattcttgccgtgtggggttcagggggcatctcctctcctctcatctttcttttttgacgatttcttcgtctctctaaaatggcctggtcatatcgcatgtgcgtaattccccccctctgaccacgtccagtccactgcaaaaattttaaccttttcttctctttttctcttccaaggccctacatttttgtactactccacatttatatgcccttcttctcctcatcctcaatctgaatccgccgttattttctctctctaactcatgtaatggtttctgttcgtgtgagcacccaccattgccacgaatcgttagagatgcagcactgctaccattttttatacaactaaaatactaatacaattaattaatggctggttgattgtgacttctggctgtggtaggggaaaaccaccccaatgtgccgtgtctgaatccaatactgtagctttctttgacttggttgggacttgcccttctttcggtgctacctggctgtgaccaattcatacaaaccgttggtgcttgttcactctgctgtctctgttggtcaatgccactggccttcccagattttgcacatgaaccttcttcgttgctccttcattccgtaatgtgtccgtttacctatgcaacaggtggagggcagaaacacctatgcaacaggtggagggcaggaactgtcttcctgcggaggtcaggattggcctcgagacgctcaagaggcgccggcttgagaggatgcgtttgactgctcagaacaatgccggcgacggtcctccggtgcccgcaaggagcggtggggatgcgctaaggactcccgcaaactgcggggtcaggttgcatgctaacaatggcacagctctacctagcagaaccacccagaacaaggacccttttgcaaagcgcagggtggacaagtttgatatgtctagcctagaatggattgacaagatcgaagaatgccctgtgtactatcctaccaaggaggagttcgaggatcccattggttatatacagaagattgcacctgtggcttcgaaatacggtactgcttccgtttctcgttgccctcatcgtctgttgacagtgtattactgattgatctgccagtctacgcagaatcttactttctaaatgaatgatcatgggctattattttctccccaggaatttgcaaaatcgtatctccagtaagcgcttctgttcctgctggtgtcgtgttgatgaaggaacagcctggtttcaagttcatgaccagggttcagccgcttcgcctcgccaaatgggctgaagatgacacggtcactttcttcatgagcgaaaggtgtggtatttcttggttcattttcattattggctgcttatctcccaggtctcatgatgcttggcatgattttgcagaaagtacactttccgggattatgagaaaatggccaacaaggtgttcgccaagaaatactcaagtgctagttgtctcccagctaagtacgtggaggaggaattctggcgcgaaattgcttttggtaaaatggattttgttgaatatgcctgtgatgttgatggtagtgctttctcctcttctcctcatgatcaacttgggaaaagcaactggaacttgaaggtgactaactctcttctgtgtttgtgtgtgtggatgtgtcgtcacatgagtgcatgtttaaatatttgctcactggtagtatgtgttttactgatcgtatttttttgtttcgtagaatttttcacggctttccaattctgtgcttagacttctgcagacaccaattccagtaagtcatttatttactacttaatgtgtttcacattctttaacatggccaaaatttcatgattgtattacactcatccaaaacagggagtaacagatccaatgctttatatcgggatgctcttcagcatgtttgcttggcatgtggaagatcattatttgtacaggtataaattctcggttctccatggttactctttcttttttgctcgtaattaatactggtgttctgacattttattcatatgaccagcatcaattaccatcattgtggggcatttaagacatggtatggcataccgggtgatgctgctcctgggtttgaaaaggtggctagccagtttgtatacaacaaggatattttggttggtgaaggagaggatgcagcatttgatgttctcttggggaagacaacaatgttccccccaaatgtcttgttagaccacaacgttcctgtttataaagctgtgcaaaaacctggggagtttgtcattactttccctcgttcctaccacgcgggtttcagccacggtatgtatctttcagtttgtgcatgtgttataacgccactatcatatgcatagtattctaaggaatgtttcaactacccaggcttcaattgtggcgaggctgtcaactttgctatcagtgactggtttcctctgggttctgtggccagcagacgctacgcgcttctgaacagaacacccttgcttgcacacgaggagttactttgccgttctgcagtgcttctgtcccacaaactgttaaacagcgacccaaaatccctcaataaatctgagcatccacattcacagcgttgtttgaagtcttgctttgtgcagttgatgcgattccagagaaacacacgtggcctacttgctaaaatgggctctcagatacattataagccaaaaacatacccgaatctctcatgtagcatgtgtcggcgtgattgctacattacacatgtgttgtgtggatgcaactttgacccagtctgtcttcatcacggtaggaaatgttagcattgctcttttgcactttcttttgtattttacctaatactttggttattggactgcagaacaagaactccggagctgcccttgtaaatctaaccaggttgtctacgttagggaggacatacaggagctagaagctctatcaagaaaatttgagaaggatatttgcttggataaggaaataagtggttttgactcatacaagcaggccgaaaagaatgagccattttttgagataactcggaacctcaggaacactgaagtaaatttgatagaggatgccttctcaggagcaactgctgctgatgctgcaaagagttctcctgcaacgtcaacactgacatcttttgcacaacatgatgtgcctgttcttgctgaagcaattgtaggtttaccatcatgcatatatttccagctgttatctttctgttgggttaatgttcttgttattttatttaggtctgtgctaatcaagccgaccaattatactccaccaccgagcaaaccatcagctcacctttagtcaaaggaactgatgctgtgggtgcaaattcatccagcatggctgatgctaataacggaactggttcttgtaatgcttcagctgtggaatacagtggaaattcagattctgaatctgaaatatttcgagtcaagcgcaggtctggcgtatcagtaaagcctgcatctgatgccaagacatcaaacttgtctgatcaacaggtacgttaaattttcatcttttacacccctttggcttatcatcaacttttaggtactccctccggttctaaattaattgacgttttggacaaggttgagatcaattttttataactttgaccatcaataactttaaaaatatttagtttaaagaaactaaaacaacatatatagatttgtcttttaaagcactataataaaagtaaacatgtatttatttattatatatattatagtagaaaaataaggtcaaagatatatcttgtagaccgtgtcattgtccaaaatgtcaattaaaatggaaccggagggagtaattgcactgtttaagggaaaatacttcatgtaagaataaatgacatgctatataaatggccaggcatctccagttgtcgaggtcatttgatagataataatgggcaatcatgtcataaataaataagttgcagctctagttatgtattaattaagttcctgtaccattttacaccaaggtccaagggtctttatatgaaggatgacatacgggcccatagcatttagttgtcctattttagatagtgcttacttttggttctgatgtaaaatactggaatcaggttctcaggcggttgaagaaggtgcgccctgaaatacaacagcacaataagcgaccagaagactatggtcactgttcagttccctcaggtcgtatgagtatgaagaatttgaattcatcctcctcatgtggtgaagaacactggaggatgaagcggcggcagttggagactcagcaggatgagagcagttattctgcaaagcagaagtcgtactcgtatccatccaccagctattctttccgaggagagtttgtggaaatgagtagagatgctgctgcagaagtccgaccaaagcgactgaaaatccggctaccttcttctagcacgaacagagtggttgagcagggcagttcagggcaaagatttacaagggatgacaagtcgcttggttgttggcctgcaatttagaatttagaaaaaaatgctgacgcaggtgctaacctctgatggagataaagatttccttgtttaggtggggctgttgactacacgaaatgatagggctgggatggatcgatgaggttgaatataaatgattagcacagaagctgactgactttagaaggctggttaatcgattctttgtgcagcagtgcctccaatttgaggcacatctaggcacggttagaagagacagacacatgacgattcttgttgctggaggttctgggtcactgctttgctgctgtttgatgcctgcactgcaagtgacgtacacacactataggacctcgctctaccctttgattatatctctctatttttcttcttctttgtcagcaaccttagctgctgctactctatagctaactgtattctttcatacgcttgttccatcaagttaatctgctgcttaatgccattgattc</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0577600, RefSeq:Os10g0577600