Difference between revisions of "Os04g0524300"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Labs working on this gene)
Line 13: Line 13:
  
 
==Labs working on this gene==
 
==Labs working on this gene==
[[File:FIG2.png]]
+
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.[[File:FIG2.png]]
  
 
==References==
 
==References==

Revision as of 13:03, 4 June 2014

Please input one-sentence summary here.

Annotated Information

Function

OsRR5 belongs to thirtten A-type response regulator (RR) genes in the rice genome. The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes. OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous ytokinins.

Expression

Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower. The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.

Evolution

Labs working on this gene

Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.FIG2.png

References

1. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng

 Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins
 Genetics and Molecular Research, 2010, 9(1): 348-359

2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana

 Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)
 BMC Plant Biology, 2006, 6: 1

3. Yukihiro Ito;Nori Kurata

 Identification and characterization of cytokinin-signalling gene families in rice
 Gene, 2006, 382(1): 57-65

Structured Information

Gene Name

Os04g0524300

Description

Similar to ZmRR2 protein (Response regulator 2)

Version

NM_001059883.1 GI:115459495 GeneID:4336439

Length

1220 bp

Definition

Oryza sativa Japonica Group Os04g0524300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:26625768..26626987

Sequence Coding Region

26625843..26625963,26626041..26626087,26626190..26626267,26626379..26626449,26626539..26626626

Expression

GEO Profiles:Os04g0524300

Genome Context

<gbrowseImage1> name=NC_008397:26625768..26626987 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:26625768..26626987 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcgtgacggctgtggacagcgggaagagggcattggagctgctaggctcggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtga</cdnaseq>

Protein Sequence

<aaseq>MATCRSRGVERGGAPHVLAVDDSSVDRAVISGILRSSQFRVTAV DSGKRALELLGSEPNVSMIITDYWMPEMTGYELLKKVKESSRLKEIPVVIMSSENVST RINRCLEEGAEDFLLKPVQPSDVSRLCSRVLR</aaseq>

Gene Sequence

<dnaseqindica>76..196#274..320#423..500#612..682#772..859#acggtcacacacagaattcctaaagccgacttggcttttgctcgcgagtaggactgtaggagagatatcgatctgatggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcggtgagctgctggctctcttgctcctgtaccacatattgtccatcctcgttcttcttcttacgtgtgcatgtgtgtagtgacggctgtggacagcgggaagagggcattggagctgctaggctcggtgagtctccggcatcctctgcctttttgctgttggttacgcaaatgtggaggtgtgttttgcctgcgaggccgtaaacgtttttttttctttggctcgcaggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggtaatccggtgatatcaccaccgttatttgggccaacttccatagtactcctcgtgcatattactactcaccttttctgatttgacaatagaaaatggcatatctttgcaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtttgtgtgcacagtatcggtgcccatatctgcccaaatactatcaagatatactcatcttcttgacacgtttttggttaatttgccaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtgagccgtgcaggcggcggccggtcgggtgggcgtcgtgggcgactgaagcgtccctgcatgcatatgcggcttcagtgttttgggggttggaattaatagcagcagaagcagaagcagtagtagtagtgattagtggtagccaaacgcactgtgcgcttgcagatgttgtggttaatgggctgaatttgcctctccctttctctatttttctcattccgaatgtcatgttctagctgttccctgtgtcgatctagaatgcagtttgtcccatcggtttgtccatcccagttgaaaaacctgttgcaacaaatgtctcaattttatgttcttaacagttcatccgttttactagttatattcat</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0524300, RefSeq:Os04g0524300