Difference between revisions of "Os10g0177200"

From RiceWiki
Jump to: navigation, search
(Function)
(Expression)
Line 6: Line 6:
  
 
===Expression===
 
===Expression===
The data from both microarray and qRT-PCR analysesshowed that the expression levels of OsDSR-1 were up-regulated by 60- and 5-fold in the panicle of rice at booting and heading stages, respectively,under drought stress condition relative to panicles under normal growth conditions.[1]Overexpression of OsDSR-1 in Arabidopsis enhanced the inhibition effect of ABA on the LR development and promoted the LR development under high-potassium conditions.
+
The data from both microarray and qRT-PCR analysesshowed that the expression levels of OsDSR-1 were up-regulated by 60- and 5-fold in the panicle of rice at booting and heading stages, respectively,under drought stress condition relative to panicles under normal growth conditions.[1]Overexpression of OsDSR-1 in Arabidopsis enhanced the inhibition effect of ABA on the LR development and promoted the LR development under high-potassium conditions.[1]
  
 
===Evolution===
 
===Evolution===

Revision as of 14:17, 4 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Rice gene Oryza sativa Drought Stress Response-1 (OsDSR-1) was one of the genes identified to be responsive to drought stress in the panicle of rice at booting and heading stages by both microarray and quantitative real-time PCR analyses. OsDSR-1 encodes a putative calcium-binding protein, and its overexpression in Arabidopsis rendered transgenic plants to produce much shorter lateral roots (LRs) than wild-type (WT) plants in the medium supplemented with abscisic acid (ABA), suggesting that OsDSR-1 may act as a positive regulator during the process of ABA inhibition of LR development.[1]OsDSR-1 may function as a calcium sensor of the signal transduction pathway controlling the LR development under high-potassium conditions.[1]Thus, the OsDSR-1 protein may participate in signal transduction, regulating the LR development of plants in response to ABA and potassium.[1]

Expression

The data from both microarray and qRT-PCR analysesshowed that the expression levels of OsDSR-1 were up-regulated by 60- and 5-fold in the panicle of rice at booting and heading stages, respectively,under drought stress condition relative to panicles under normal growth conditions.[1]Overexpression of OsDSR-1 in Arabidopsis enhanced the inhibition effect of ABA on the LR development and promoted the LR development under high-potassium conditions.[1]

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Institute of Subtropical Agriculture,Chinese Academy of Sciences,Changsha, Hunan 410125, People’s Republic of China

Laboratory for Agro-ecological Process in Subtropical Region,Institute of Subtropical Agriculture, CAS,Changsha, Hunan 410125,

References

[1]Xu Ming Yin; Pedro S. C. F. Rocha; Man Ling Wang; Yu Xin Zhu; Luo Ye Li; Shu Feng Song; Xinjie Xia.Rice Gene OsDSR-1 Promotes Lateral Root Development in Arabidopsis Under High-Potassium Conditions,Journal of Plant Biology,2011,54(3):180-189

Structured Information

Gene Name

Os10g0177200

Description

EF-Hand type domain containing protein

Version

NM_001070778.1 GI:115481299 GeneID:4348196

Length

4409 bp

Definition

Oryza sativa Japonica Group Os10g0177200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:5006157..5010565

Sequence Coding Region

5006501..5006737,5006845..5006970,5007079..5007297,5007462..5007758,5010044..5010325

Expression

GEO Profiles:Os10g0177200

Genome Context

<gbrowseImage1> name=NC_008403:5006157..5010565 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:5006157..5010565 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgtcgggcaagatggagaacggccagcagcagcagcagcaggaggtgaggaggaggaggaacggcgaggtggtggtggacgggtcggagatcctgcagctggtggagaacaaggaggcgtttggtaagttcgtggagcagaagttcaggctgctcgacgccgacggcgacgggaggctgtcggtgagggagctccagccggccgtcgctgacatcggcgccgccatcgggttgccggcgagggggtcgtcggcgcaggccgaccacatctactctgaggttcttaacgagttcacaaaagggaagaaagaatcggtgagcaagtcagagttccagcgtgtcctctctgacatacttcttggcatggcggctggactaaagagggaccccattgtgatcttgaggattaacggtgaagatttgaatgaatttgttgagagcccaaggtacgaaccggagatggctgccatattttcgcaagttgaatcaggaaattcaaccttgcagcagtgcatgctagctgctattcgacaactgacggtcgaccacggcatgccaccggcttcagattcatgggttatggagaatatcatagaacctgcattgcaagaactccatggtgataacctggagcaacctgtcactcaagaggtcttcttccaggaattcagaaagttcttggcaatcctcacgcagcgactccaagggcaccctgtgattgtagcacataccgagaacacctttgatgggaatggtatcaagaagctgctgtcaaacaagctcgaattagataagctgttggattgtgtttggagaggcgtaccgaaagaaaaagatagaacagcgaagcagtacattcgggttgcgttcgataggatggctgactccataaatctaccaccatatggagctgttgaacaggtagatgctgtggtcgatgaggcgttcaagatggcgaaagccgaggacgggaaggcggtggatgaaacggagttcaagaaattgctcactgagatccttggggcagtgatgctgcagctagatggcaatccaatatcggtttcgaccaacagtgtactccatgagccaatgtccacttcttccaccctgctttcgccatcgccgccgtcgccaatggtgtcatcaccgagtgaatag</cdnaseq>

Protein Sequence

<aaseq>MASGKMENGQQQQQQEVRRRRNGEVVVDGSEILQLVENKEAFGK FVEQKFRLLDADGDGRLSVRELQPAVADIGAAIGLPARGSSAQADHIYSEVLNEFTKG KKESVSKSEFQRVLSDILLGMAAGLKRDPIVILRINGEDLNEFVESPRYEPEMAAIFS QVESGNSTLQQCMLAAIRQLTVDHGMPPASDSWVMENIIEPALQELHGDNLEQPVTQE VFFQEFRKFLAILTQRLQGHPVIVAHTENTFDGNGIKKLLSNKLELDKLLDCVWRGVP KEKDRTAKQYIRVAFDRMADSINLPPYGAVEQVDAVVDEAFKMAKAEDGKAVDETEFK KLLTEILGAVMLQLDGNPISVSTNSVLHEPMSTSSTLLSPSPPSPMVSSPSE</aaseq>

Gene Sequence

<dnaseqindica>3829..4065#3596..3721#3269..3487#2808..3104#241..522#acttcagctgcaacggagaaatcgacgcaaaaacaaaccgcagaaagaaagaaaaaaacaagaaaggcaagaaagctactggttttcagctcgatcatcttgtgattagctcacacactttttgccacctttttgcgagagactgatcgaagtatactcttcgtctaggttgtgttcacggggagcttggtgccattgctgcaagttggggaactttttgggttgtagaaaaggaagctgatggcgtcgggcaagatggagaacggccagcagcagcagcagcaggaggtgaggaggaggaggaacggcgaggtggtggtggacgggtcggagatcctgcagctggtggagaacaaggaggcgtttggtaagttcgtggagcagaagttcaggctgctcgacgccgacggcgacgggaggctgtcggtgagggagctccagccggccgtcgctgacatcggcgccgccatcgggttgccggcgagggggtcgtcggcgcaggccgaccacatctactctgaggtagtaattccttgtatatcctgatgttcatttatttctagagggaaatacatcctgatgtgtgtcagtgtgtcatgaagttgacgctacctacagctgttaactgtcttaatgtctttaccgatttggtcgatttttgtcatgttcatgttcatgtgtcacgaacgtattttagaattaagataggtttatatatatatatatttcatatttcaaaatcttttagaagatacaacagatttcttgtaattaatggtacatatactaactccgttttgctgttgattttggaaacacatactacctccgttttgcggttgattttagaaactcttgtctaagtatcaatttatctttttattttttcactaaagataaaataagcttgactcatgcattttttttcatattttcgactaatctatttgttttgtcattaaagataatataagcatgactcacgatcgtaaaatttgtcaactttttttagcatttttatttatttattaaataaataaatcttgtatgagagtacaaacaagagggaagtgtaggcgaaataaactaataaggagtgaggataaagagagctattcatctacaaattctagatgttcagtagaacattgttaatggaaatacaatggtgagaaaaaaaatagatagaaaaacttaaaaatgtttattttcatatttgtgactaatggtcgacaaaggttatgtacaaaagtcaacattacaatatatttaaaaagggagcaaacgttatatatcaaagtcattgttatcatatatctaaaaatggagggagtagtttaattataattgttaaagtttgattttctcatggcattcaaagtcagccagcgtataataaaattggttaaaaggaagcgatcaaaatgggggagagtgtttctcttttcttaaacaaggagatagcatattgtacatacgggctcattattttgattctactaaccgttgatgcttttcactaagcattactccttcagttccaaaatataagggattttgatttgataatacgcatcctagtaatacgaatgtagatagtccagattcgtagtattaggatatgtctatccaaccaaaattgtttgaattttgtgacggagggagtacattttgggcatttctatttttttaaaataatggaaaaccaaaaatactggttggatacttagaaccgacacctatgtcaattggcataggtgacgccaaattggtgtcggttgagaaaccggcacttataattaagtggtttccaaccagcatctatatggtgctctgtaatagttattatagcgttatgcctcttcaaggacacgaataatgcattaaaaaaatcagacacttcttttatgtttattttgttcagtttagtaatatgatttggctcatctggccatgacagaaacgaatatgaagttttatggtggctctaggaagcaaattaagcaattattcagaaaaaaagttataatctgacagtacaaaaaaatgatgcactagatttcatggaaaatggaaaagatgtgttttcactttacgggtttcattacagtatttagtacattacagatgaaaaggttttatggactcccataaaaaagggtttttttggacttgttctttttgaaattgtctgaagaatttcttttggaaatgaatacactcagggtgaatatagaagaaagtattttgagattttcctataattccactagagtatgagtattgctttgacctgccaaatggaagaaactggaacgtgcctaaattaaccaggaaaacgtcacattctaatgatctagccccaagacttatcagttgacagaacaagataatcttactgaaagtgactgctcttgtgtggccaaagtcatcatccttttcaaattcccatccaatttgtctagcatgttctaggtgtctacctcctgaacattctgatatcgctgtaacttatcattccggtttcttagacacatcttttcgaaagatgatgcctataacgatttcttagataaatattagttccttttgacacatgttctcttgcttactcttgacagtgacaaaaataatggtttactggattttcttccagagaggtgtctgttcatgagctctacttccattatacattgtcagtaacttgcagtaaaattttaatcacatttcctggataatcttgaaccaaaacatccgataattactgttgtctaattcatctcatggctcatggaattaacctgcaggttcttaacgagttcacaaaagggaagaaagaatcggtgagcaagtcagagttccagcgtgtcctctctgacatacttcttggcatggcggctggactaaagagggaccccattgtgatcttgaggattaacggtgaagatttgaatgaatttgttgagagcccaaggtacgaaccggagatggctgccatattttcgcaagttgaatcaggaaattcaaccttgcagcagtgcatgctagctgctattcgacaactgacggtcgaccacggcatgccaccggcttcagattcatgggtaattgccaatgaatgtgttacataattcagagcagaaaacgaaatcatttcatacagggtaacaaatataacagagtaacagttattctgttaccgagactgacaaaacagagtggagatgaggttaagagagaaattagtaaggttggctgttttttacaggttatggagaatatcatagaacctgcattgcaagaactccatggtgataacctggagcaacctgtcactcaagaggtcttcttccaggaattcagaaagttcttggcaatcctcacgcagcgactccaagggcaccctgtgattgtagcacataccgagaacacctttgatgggaatggtatcaagaagctgctgtcaaacaagctcgaattagataaggtacggtattgtttctatcctcgatgtcatcatcttcccataaaaatatactcctatatattagtgttacttcataccgatctacttatactatcttttgtgatcaagctgttggattgtgtttggagaggcgtaccgaaagaaaaagatagaacagcgaagcagtacattcgggttgcgttcgataggatggctgactccataaatctaccaccatatggagctgttgaacaggtagaatttcatttgctaccaatcatttcatcagtaattttcaggaaaaccagccaaaacacattgtatgttcagatctaaggcttatggtaagttggtaactgcaggtagatgctgtggtcgatgaggcgttcaagatggcgaaagccgaggacgggaaggcggtggatgaaacggagttcaagaaattgctcactgagatccttggggcagtgatgctgcagctagatggcaatccaatatcggtttcgaccaacagtgtactccatgagccaatgtccacttcttccaccctgctttcgccatcgccgccgtcgccaatggtgtcatcaccgagtgaatagaagcaagatggaaggaagctgatcatagaatggacagtggagaatataatttccactggtggtaacagtaactgcaatataatgctggttttcttctgatcaatgaacaaactgcagtaacttgatagttgccatgtaactggagacctggtgcaaatatgtttgtgttggtgtttgtaactacgttctaagtgtttagtgtcggaataataaggcttctaattaagccagcagttgaacaacggggaataatttatttcaagcttttgttttgggtgcagcagatgcttggaaatggcaagcttggggaccaataatggtatgataaaactatgttagtaact</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0177200, RefSeq:Os10g0177200