Difference between revisions of "Os01g0227100"

From RiceWiki
Jump to: navigation, search
(nyc1 is a recessive mutant in rice and it canretain green leaves during senescence)
Line 1: Line 1:
 
Please input one-sentence summary here.
 
Please input one-sentence summary here.
 
+
nyc1 is a recessive mutant in rice and it canretain green leaves during senescence.
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Line 6: Line 6:
 
The symbol of the gene “Os01g0227100” is NYC1.
 
The symbol of the gene “Os01g0227100” is NYC1.
 
nyc1 is a recessive mutant in rice, nyc1 was isolated as a stay-green mutant in the paddy field. nyc1 remains green until just before death in natural senescence and does not show yellowing.In nyc1, most light-harvesting complex II(LHCII )members are selectively retained during senescence, in contrast with the wild type. nyc1retains granal structure during senescence.
 
nyc1 is a recessive mutant in rice, nyc1 was isolated as a stay-green mutant in the paddy field. nyc1 remains green until just before death in natural senescence and does not show yellowing.In nyc1, most light-harvesting complex II(LHCII )members are selectively retained during senescence, in contrast with the wild type. nyc1retains granal structure during senescence.
1.Inhibition of LHCP Degradation in nyc1
+
1.Inhibition of LHCP Degradation in nyc1.
  In wild-type senescent leaves, the abundance of these protein complexes was reduced remarkably at 5 DDI;In nyc1, the abundances of chlorophyll abinding proteins, LHCP dimer (whose major component is LHCI), PSI reaction center complex, and CP43/47 were reduced to similar levels as in the wild type at 5 and 7 DDI, but the LHCP trimer and monomer were apparent even at 7 DDI.
+
  In wild-type senescent leaves, the abundance of these protein complexes was reduced remarkably at 5 DDI;In nyc1, the abundances of chlorophyll abinding proteins, LHCP dimer (whose major component is LHCI), PSI reaction center complex, and CP43/47 were reduced to similar levels as in the wild type at 5 and 7 DDI, but the LHCP trimer and monomer were apparent even at 7 DDI.  
 
2.Inhibition of Degradation of Pigments Strongly Bound to LHCP in nyc1.
 
2.Inhibition of Degradation of Pigments Strongly Bound to LHCP in nyc1.
By 8 DDI, the amounts of most photosynthetic pigments exceptb-carotene were significantly reduced in the wild type. In nyc1, the degradation of not only chlorophyllaand chlorophyllbbut also neoxanthin and lutein was apparently inhibited.  
+
By 8 DDI, the amounts of most photosynthetic pigments exceptb-carotene were significantly reduced in the wild type. In nyc1, the degradation of not only chlorophyllaand chlorophyllbbut also neoxanthin and lutein was apparently inhibited.
3.NYC1 is Required for Proper Chloroplast Degeneration。
+
3. the degradation of chlorophyll b was severely inhibited and light-harvesting complex II was selectively retained during senescence, resulting in the retention of thylakoid grana even at a late stage of senescence.
The grana stacks are stable during senescence innyc1, unlike in the wild type.
+
4.The protein encoded by NYC1 is necessary for catalyzing the first step of chlorophyll b degradation. Analysis of the nyc1 mutant, which shows the stay-green phenotype, revealed that chlorophyll b degradation is required for the degradation of light-harvesting complex II and thylakoid grana in leaf senescence.  
 +
 
  
 
===Expression===
 
===Expression===
 
Please input expression information here.
 
Please input expression information here.
nyc1 was located between cleaved-amplified polymorphic sequence (CAPS) markers P0443E07.24 and P0452F10.5. Five genes were predicted in this≈40-kb region. One of them seems to encode a member of the short-chain dehydrogenase/reductase (SDR) family . Sequence analysis of thenyc1-1allele revealed a single base pair change, a G-to-A substitution, at the first exon/first intron junction, which may prevent splicing of the first intron and result in the early termination of translation.
+
nyc1 was located between cleaved-amplified polymorphic sequence (CAPS) markers P0443E07.24 and P0452F10.5. Five genes were predicted in this≈40-kb region. One of them seems to encode encodes a protein with 504 amino acids belonging to the SDR family.The amino acid sequence of NYC1 contains all important amino acid residues conserved in the classical SDR family, including a dinucleotide binding motif (TGXXXGXG) and a catalytic site (YXXXK). NYC1 has an Arg at key position 15 (180th amino acid) and another at key position 37 (202nd amino acid). Sequence analysis of the nyc1-1 allele revealed a single base pair change, a G-to-A substitution, at the first exon/first intron junction, which may prevent splicing of the first intron and result in the early termination of translation.
 
===Evolution===
 
===Evolution===
 
Please input evolution information here.
 
Please input evolution information here.

Revision as of 15:26, 4 June 2014

Please input one-sentence summary here. nyc1 is a recessive mutant in rice and it canretain green leaves during senescence.

Annotated Information

Function

Please input function information here. The symbol of the gene “Os01g0227100” is NYC1. nyc1 is a recessive mutant in rice, nyc1 was isolated as a stay-green mutant in the paddy field. nyc1 remains green until just before death in natural senescence and does not show yellowing.In nyc1, most light-harvesting complex II(LHCII )members are selectively retained during senescence, in contrast with the wild type. nyc1retains granal structure during senescence. 1.Inhibition of LHCP Degradation in nyc1.

In wild-type senescent leaves, the abundance of these protein complexes was reduced remarkably at 5 DDI;In nyc1, the abundances of chlorophyll abinding proteins, LHCP dimer (whose major component is LHCI), PSI reaction center complex, and CP43/47 were reduced to similar levels as in the wild type at 5 and 7 DDI, but the LHCP trimer and monomer were apparent even at 7 DDI. 

2.Inhibition of Degradation of Pigments Strongly Bound to LHCP in nyc1. By 8 DDI, the amounts of most photosynthetic pigments exceptb-carotene were significantly reduced in the wild type. In nyc1, the degradation of not only chlorophyllaand chlorophyllbbut also neoxanthin and lutein was apparently inhibited. 3. the degradation of chlorophyll b was severely inhibited and light-harvesting complex II was selectively retained during senescence, resulting in the retention of thylakoid grana even at a late stage of senescence. 4.The protein encoded by NYC1 is necessary for catalyzing the first step of chlorophyll b degradation. Analysis of the nyc1 mutant, which shows the stay-green phenotype, revealed that chlorophyll b degradation is required for the degradation of light-harvesting complex II and thylakoid grana in leaf senescence.


Expression

Please input expression information here. nyc1 was located between cleaved-amplified polymorphic sequence (CAPS) markers P0443E07.24 and P0452F10.5. Five genes were predicted in this≈40-kb region. One of them seems to encode encodes a protein with 504 amino acids belonging to the SDR family.The amino acid sequence of NYC1 contains all important amino acid residues conserved in the classical SDR family, including a dinucleotide binding motif (TGXXXGXG) and a catalytic site (YXXXK). NYC1 has an Arg at key position 15 (180th amino acid) and another at key position 37 (202nd amino acid). Sequence analysis of the nyc1-1 allele revealed a single base pair change, a G-to-A substitution, at the first exon/first intron junction, which may prevent splicing of the first intron and result in the early termination of translation.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here. Graduate School of Agricultural and Life Sciences, University of Tokyo. Institute of Low-Temperature Science, Hokkaido University. Institute of Radiation Breeding, National Institute of Agrobiological Sciences. Chugoku National Agricultural Research Center for WesternRegion, National Agriculture and Bio-oriented Research Organization.

References

Please input cited references here.

[1] Yutaka Sato1,+, Ryouhei Morita2, Susumu Katsuma1, Minoru Nishimura2, Ayumi Tanaka3 and Makoto Kusaba1,4,*(2009)Rice NON-YELLOW COLORING1 Is Involved in Light-Harvesting Complex II and Grana Degradation during Leaf Senescence.The Plant Journal.57:121-130.

[2]Makoto Kusaba,a,1Hisashi Ito,b Ryouhei Morita,cShuichi Iida,dYutaka Sato,aMasaru Fujimoto,aShinji Kawasaki,eRyouichi Tanaka,bHirohiko Hirochika,eMinoru Nishimura,cand Ayumi Tanakab(2007)Two short-chain dehydrogenase/reductases, NON-YELLOW COLORING 1 and NYC1-LIKE, are required for chlorophyll b and light-harvesting complex II degradation during senescence in rice.The Plant Cell.19: 1362–1375.

Structured Information

Gene Name

Os01g0227100

Description

Glucose/ribitol dehydrogenase family protein

Version

NM_001049003.1 GI:115435419 GeneID:4327178

Length

6295 bp

Definition

Oryza sativa Japonica Group Os01g0227100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:7023277..7029571

Sequence Coding Region

7023363..7023680,7024607..7024685,7024796..7024931,7025304..7025378,7025493..7025688
,7025875..7025943,7026095..7026234,7026405..7026527,7027370..7027562
,7028852..7029037

Expression

GEO Profiles:Os01g0227100

Genome Context

<gbrowseImage1> name=NC_008394:7023277..7029571 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:7023277..7029571 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccgccgccgcggtggtccacctctccgtgcacggccgcctccgccgctcgccggagctccacgcccggccataccaccgcccgtcgctgctccggtgccgcgcgttcaagcaggaggccgataacggcggggaggaggcttcgtcgtcgccgccgccgccgacgacggccgaggcgcggaggcgcaggaagggcccgctgtacaagctgaaggcggcgattcaggggctcgccgggtcgcggtcggcggccgcggaggcgtacgggggcgagtaccagcgcgccgtcgagaaggccgaggagatcttcttctcggttgctacgcaagtaggccgatatgttatcactatgatgagcagcggtgttgtacttggagttggatttcagttatcaggcggagacagccaaatgaatacactaatttggtatagttggctcgggggagtaattattggcacgatgataggtgcaaacagtgtcctagaggaacactgcaaagctggacctcgcaatgttgtcataactggaagcacaagaggattagggaaagcacttgctcgggagttccttctttctggagatcgtgttgtaattgcttcacgcagccctgaatcagtccttcagaccatcaacgagcttgaagagaacatacaggagggcttgtcagttgcgaaaaagaaacagagagaaattttgctacatgccaaggttgttggtacatcatgtgatgtttgtaaaccagaagatgtgaaaaagttggtgaactttgccaaggatgagcttggatcaattgatatttggataaataacgctggcacaaacaaaggttttaggccactggtaaacttttcagatgaagatatttctcagattgtctcaacaaacctagttggctctttactgtgcaccagagaagccatgaatgtcatgcaacaccaacaaaagggaggtcacgtatttaacatggatggagcaggttctggaggatcaagtacaccattaacagctgtttatggttcaactaagtgtggccttagacagtttcaagcatcacttctgaaggaaagcagaagatcaaaagttggtgtacacactgcttctcctggaatggtccttacggacctccttttgagcggttcttctctgagaaataaacagatgttcaatttaatatgtgagcttccagaaacagttgcaaggacattggttccgaggatgcgagttgtgaaaggaagtggaaaggcgataaactacttgacaccaccaaggatcttgcttgccttggttactgcatgggttcgccgaggccgatggtttgatgaagagggaagagcagtatatgcagcagaggctgatagaatccgtaattgggctgaaagtcgagcacgcttctctttcacagatgccatggagatgtacacagaaaacacatgggtttctgtgttctcgctctctgtcgtctgcgcattcataattctttccagctcaggtggacctcttccaggcacatga</cdnaseq>

Protein Sequence

<aaseq>MAAAAVVHLSVHGRLRRSPELHARPYHRPSLLRCRAFKQEADNG GEEASSSPPPPTTAEARRRRKGPLYKLKAAIQGLAGSRSAAAEAYGGEYQRAVEKAEE IFFSVATQVGRYVITMMSSGVVLGVGFQLSGGDSQMNTLIWYSWLGGVIIGTMIGANS VLEEHCKAGPRNVVITGSTRGLGKALAREFLLSGDRVVIASRSPESVLQTINELEENI QEGLSVAKKKQREILLHAKVVGTSCDVCKPEDVKKLVNFAKDELGSIDIWINNAGTNK GFRPLVNFSDEDISQIVSTNLVGSLLCTREAMNVMQHQQKGGHVFNMDGAGSGGSSTP LTAVYGSTKCGLRQFQASLLKESRRSKVGVHTASPGMVLTDLLLSGSSLRNKQMFNLI CELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWVRRGRWFDEEGRAVYAA EADRIRNWAESRARFSFTDAMEMYTENTWVSVFSLSVVCAFIILSSSGGPLPGT</aaseq>

Gene Sequence

<dnaseqindica>87..404#1331..1409#1520..1655#2028..2102#2217..2412#2599..2667#2819..2958#3129..3251#4094..4286#5576..5761#gccctctcctaaaaccaaggaacccaaccccacaaaaaagcgtaggacgccggagtgcgaaatccttatccgctcgcggcgacgccatggccgccgccgcggtggtccacctctccgtgcacggccgcctccgccgctcgccggagctccacgcccggccataccaccgcccgtcgctgctccggtgccgcgcgttcaagcaggaggccgataacggcggggaggaggcttcgtcgtcgccgccgccgccgacgacggccgaggcgcggaggcgcaggaagggcccgctgtacaagctgaaggcggcgattcaggggctcgccgggtcgcggtcggcggccgcggaggcgtacgggggcgagtaccagcgcgccgtcgagaaggccgaggagatcttcttctcggtgagctccattcctgaaccccctcaagctcccccgcaagcgcagtttctctacatgataatatgataatatgtttatggccgattttttcatctgatcgtgtgatctactagtacgactgcctttaattgttgccacgtatcgggaggctcaaccactcaatgcgttagcgagcgctactaccttaatcagctcttgcttagctgcatatgggaattgcacccatcagatgctacagctacaagtgagtttaggcgatctatgttgtttcaatgggtgttaggatccaatacactagctgtggcacaaatcgatgagctgatcaacactaatcagcttgtttcttactagtaatacagtaggctccagttactgtgaaattctgtaatgtcagttccctttatgtttatgtgctggagagcaaattctgcctgcgctaaaattaatcgcaggcctgtgaagcaatttgcctgggcagaggatgcggctcgtagccagaggtgtcattttgtgtagcctttgttgcttttgaaactattttaaacttctttgaaactcgctcttgattaaatttacttcgcccctcatttatatgggcctagattctctggttcttgcatctaccattgtatggggggcatgggctgccaggctcatggttttacatgtccgactgtaagtgcatgcacaggcctgctttatagttcaattgaattgcttcctaggcatgctgattctttgtattgatataaataaaatctccggtatcggctgattctctaacctaagcacatcagtaattttctatttgttgcaaacctgaacagagtggttctgaatttatcactactgagttgtaggatcaactccttttctgaaataggtgttctttttttcaaattgacttatttccttctccttttcaggttgctacgcaagtaggccgatatgttatcactatgatgagcagcggtgttgtacttggagttggatttcagttatcaggttagttacattcatttgatatattgcattgcctttggatacttctgtttttttccctacaatgggcattttcagagtttcagtaatgacctagctacctttctatttaggcggagacagccaaatgaatacactaatttggtatagttggctcgggggagtaattattggcacgatgataggtgcaaacagtgtcctagaggaacactgcaaagctggacctcgcaatgttgtcataactggaaggtaacccattttgcattcttcctttcacatgccatctgaatcttttgctaggaagcatgcatactgtgagtacaggtcaaaggtaataatcaaaactaatgaatttattcctagataggaaatactatttcaccttctattattctctattttcttatttgatgagtggagtataaccataacaatcaccaagtttatacgggttggtgcatagaggagattatgaggtgcagtcatatgaacaaatcattaaagtaacctcataaacatgttaatataaacatgacttctcattgcatcaattgtgagctgatttcttattagtatccatgttctgcaatcaacattgaagttatagtttgattttggcagcacaagaggattagggaaagcacttgctcgggagttccttctttctggagatcgtgttgtaattgcttcacgcaggtggtactcatagacatgtagctcaatgtgtgttgttgttgcatatccatgatattctttttatgaaatgcaatgcgttgtcctagttttaaatatcctattttttgaaggcagccctgaatcagtccttcagaccatcaacgagcttgaagagaacatacaggagggcttgtcagttgcgaaaaagaaacagagagaaattttgctacatgccaaggttgttggtacatcatgtgatgtttgtaaaccagaagatgtgaaaaagttggtgaactttgccaaggatgagcttggatcaattgatatttgggtaaataatttacttttacatatctatccccatcatttattctgcattatttcacggtagggtactcagttggatacttggattgagtgcacaagtttttgtacttataacctttttattttgttctgtactgtggcatcgcagaatgtacttaacatgtgctattcttcttattcttatgtatagataaataacgctggcacaaacaaaggttttaggccactggtaaacttttcagatgaagatatttctcaggtacgttaattatcttcggaaaatcagagtcttttccattctaatagagttcatagaactatattcgtcatgcaacctgacttagttatttcatcttatttttctttctgcttagcctaaacaacattattgtgtccttttctgtttgcagattgtctcaacaaacctagttggctctttactgtgcaccagagaagccatgaatgtcatgcaacaccaacaaaagggaggtcacgtatttaacatggatggagcaggttctggaggatcaagtacaccattaacagctgtgtaagtacctaatgatttcaaatttttaatgctccactgttcgtgtagctcttatactggacagggatattgtcttgtggtttcttcattggctaaaaacgagtataattgtattgatgttgttacttgtgcagtgaaactaaaactgatactattttgcaaacttgcagttatggttcaactaagtgtggccttagacagtttcaagcatcacttctgaaggaaagcagaagatcaaaagttggtgtacacactgcttctcctggaatggtccttacggacctccttttgaggtaacctctgaagttatttagatgcaattattgatgatttgcttgtttagttcattctgaacttcaatatatttattgcttggtgcacatgttgtccaaactccaaaccacactttgtgtgatgatagtaaaacaagataagacttcaagtgcataagaagttttcagtaggatctttatggaaccacacatattggttaatcagaatttcacgctatcttcattttgaatttattttagttaatcaacaatcagaatgtctcctttgttgaatggggaagagtcaaaattttgagatacctcgctgcccaaatcttctttgtttcaatctcttctttctaggatttgatttgtggcaactatttctgtagaatcagcttcacattaattattaagttgcttttgctactacacttctagctctggcttttcctatctgctataatcccgatgacacggtaaactgggtgcgtggcggttaatcagaacctgaaagaattaatgttccattcttgtgcaaatactctgccttgtaaatccagttcaaagttgtgatgttgcacatactttatacttgtaaggcttcatagtttctgtcaatatataaataacttgtgagataacttccagatataattattacaaatgactaatgcactggaaagttctaacatattaatattttttattggtaatactatatacggagaataatatgttttttaacttcaattgatggtgcatgccacttcttccatatttatctggtcagctcttctgttgccacatgcccaactatgcagactgctttagttaacttataatccttctatcttttgcagcggttcttctctgagaaataaacagatgttcaatttaatatgtgagcttccagaaacagttgcaaggacattggttccgaggatgcgagttgtgaaaggaagtggaaaggcgataaactacttgacaccaccaaggatcttgcttgccttggttactgcatgggttcgccgaggccgatggtttgatgaagaggtatgtttcttctctatgcagctagtacttttcagctttaccttttatttcagcaatgccagtatatgaaatatgctgaattcctgcagaagccatgcgtgcaaacatgattgttgttttcattattatgcatcttgcatgcacttttcatgatattgaacctcaagacttttgagctattatgcttctgaaatagtgaaatatacatttctagagaaagagtaccaagctcttctaccgttgcaccaaatgtatatgaaactcattgttgaatataaagaacaatggacatagactattcaaattatgcctgtggtgattttcttgtaaattatgctaaataagcagtattcgttctaagactggatcaaccaggcgagtcagatcataatgaagcttgagaccagtgtccagttctgtcaggtctctacataagtaagagccataaatagggtctgtcttgatggttcagtttccaggttcattatgaccagctcagtccatcacctttactgctagttggccagagctcttctggaaggccttaggctggtcctcccctcaatggcggcttcaaacacctggttccaccatggcttagctcggtccaacagtctcagtgctattgtttgtactgcatgttaaatatgacatagttaattctcacatgtattgctggatctcacctagtccacatgaaatccagcaacagatttaactggagagaatgataggggttttaaaaagcaactgcacccgtcaaatgattgcactctagtaatattttggggctgaaatgggcacaagtatacatattgacgttttttttggtatctcactggtttattggctgtgattttgggaaagaaaatcacctgcaaattttggtaccgtcgaagcttctcaccattagattgacaattattaatggaaaaactgaatgaacacatgtattattttcgcaagatatttaggaaacatgacatttgagaaaaaaaaatgctgagaagtgggtaataatttaattataacgtttgtgttccttcagaatctttcacaatataactgaagaaaagtgctgtatacatcagtgtcttttgtgatggacaatgctccaatcatcctatgtgcaaggttgaaaatcaaacagatgaagtaaaagaatattatattcttacaaatgagagatcagcataccaagcgactttatgcatacttcacagttcataatactttcagtctgatgattaattcatgtgaatgtgtgactgatcataagcacattgcagggaagagcagtatatgcagcagaggctgatagaatccgtaattgggctgaaagtcgagcacgcttctctttcacagatgccatggagatgtacacagaaaacacatgggtttctgtgttctcgctctctgtcgtctgcgcattcataattctttccagctcaggtggacctcttccaggcacatgatcccaggagttgccaaactagatggctacacacaccatttttcttcagtacggggattctattatgtactgatatatgacacacgaaacttatgaaggggggaaattgaacccagaaagcttactgcgtacatacgcccaacggtgagaagcatcagctgccactcaccatttaaggtcaagctaaccatgtgctcagtaaaaatgggtaaatagcatttgttgtgtgggcattccactgtttgtaagctgacttgtaaaaacgtgtatctgagctaaactgagcacgaacagattcgatggacaatgttatctgctgtacatgcatgtagtaatgtagttttgatgactgtaattctctggtcgtcgcttccagttgcacggttgcaccgtatgttgcaaccaccaatagaactgaaagtaagtgagagtaatcaagccagcatctgctatgtatatatatgactcatcagtctgttatatatcacaaggaaagcttcttcaaagctaaaagcaaagctatcagtaagacagt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0227100, RefSeq:Os01g0227100