Difference between revisions of "Os04g0546800"

From RiceWiki
Jump to: navigation, search
(Function)
(Expression)
Line 19: Line 19:
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
 
 
The transcriptional level of OsERF1 increased (>20%) by 0.1 mM ethrel inducement. Further more, 1 mM ethrel was used to confirm the response of OsERF1. Compared with the control, OsERF1 mRNA accumulation increased obvious ly (>70%) after 4h inducement.
 
The transcriptional level of OsERF1 increased (>20%) by 0.1 mM ethrel inducement. Further more, 1 mM ethrel was used to confirm the response of OsERF1. Compared with the control, OsERF1 mRNA accumulation increased obvious ly (>70%) after 4h inducement.
  

Revision as of 15:28, 4 June 2014

Please input one-sentence summary here.

Annotated Information

Function

The protein encoded by OsERF1 in rice is a member of the ERF subgroup. Besides having the AP2/EREBP DNA-binding domain, it contains an alanine-rich and a serine-rich region, which have been proposed to compose a transcriptional activation domain in other transcription factors. These features, in combination with its acidic pI, relative hydrophilicity and nuclear localization, suggest that OsERF1 is a potential transcription factor.

OsERF1 expresses consistently and can be up-regulated by ethylene in a dose-dependent manner

OsERF1expr ession patt ern was analyz ed by semi-quan titative RT-PCR. OsERF1 was expressed almost equally in roots, leaves, inflorescences and buds ; in developing flowers its transcripts were accumulated equally from the male meiotic stage to mature pollen stage

Overexpression of OsERF1 in Arabidopsis causes similar phenotypes as in transgenic plants that overexpress known ethylene-responsive factors

The overexpression construct of OsERF1and the pCAMBIA1302 vector (control) were introduced into Arabidopsis. It showed that overexpression of OsERF1 results in the aberrant phenotypes.

OsERF1 can activate expression of ethylene-responsive genes

Transgenic seedlings showed short hypocotyls and roots but exaggerated hooks were not observed, which was similar to ERF1-overexpressed Arabidopsis plants. In OsERF1-overexpressed Arabidopsis plants, examination of the expression of two ethylene-responsive genes b-chitinase and PDF 1.2, which work at the down stream of ERF1 in Arabidopsis, showed that both of them were up-regulated.

Expression

The transcriptional level of OsERF1 increased (>20%) by 0.1 mM ethrel inducement. Further more, 1 mM ethrel was used to confirm the response of OsERF1. Compared with the control, OsERF1 mRNA accumulation increased obvious ly (>70%) after 4h inducement.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

OsERF1 shared high sequence identity (≥80.83%) with other ERFs, relatively low identity (≤65.98%) with DREBs and conside rably low ide ntity (≤37.7%) with APETALA2 proteins. In addition, the conserved 15th A and 20th D in the domain of EFRs, but not DREBs , are present in OsERF1. Phylogenetic analysis based on alignm ent of full amino acid sequences also revealed that OsERF1 tended to group into the known ERFs but not DREBs. Consistent with these results, a previous bioinformatic analysis shows the gene predicted on the basis of rice genomic sequences belongs to the B-3/ IX group of rice ERF gene subfamily; and characterized genes from the B-3/ IX group such as ERF1 and Pti4 are identified to be ethylene-responsive.

Labs working on this gene

Please input related labs here.

References

Please input cited references here. Yibing Hu, Lifeng Zhao, Kang Chong, Tai Wang. Overexpression of OsERF1, a novel rice ERF gene, up-regulates ethylene-responsive genes expression besides affects growth and development in Arabidopsis. Journal of Plant Physiology 165 (2008) 1717—1725.

Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF gene family in Arabidopsis and rice. Plant Physiol 2006;140:411–32.

Jofuku KD, den Boer BG, Van Montagu M, Okamuro JK.Control of Arabidopsis flower and seed development by the homeotic gene APETALA2. Plant Cell 1994;6:1211–25.

Solano R, Stepanova A, Chao Q, Ecker JR. Nuclear events in ethylene signaling: a transcriptional cascade mediated by ETHYLENE-INSENSITIVE3 and ETHYLENE RESPONSE-FACTOR1. Genes Dev 1998;12:3703–14.

Structured Information

Gene Name

Os04g0546800

Description

Pathogenesis-related transcriptional factor and ERF domain containing protein

Version

NM_001060009.2 GI:297603127 GeneID:4336571

Length

1606 bp

Definition

Oryza sativa Japonica Group Os04g0546800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:27769804..27771409

Sequence Coding Region

27770368..27771324

Expression

GEO Profiles:Os04g0546800

Genome Context

<gbrowseImage1> name=NC_008397:27769804..27771409 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:27769804..27771409 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgacggcgcgaagcatgttgcggaaccacccggaggcgtcggtgctcgacaccatccggcagcacctgctggaggagccgcgcggcggcggcggtggcgaggcggcggaggcgagcttcgggagcctggtggccgacatgtggagcgactcgctgccgttccgcgacgacgacgccgacgacatggtggtgttcggcgcgatgcgggacgcgttctcgtgcgggtggctgcccgacggcgtgttcgcggaggtgaagccggagcccctgctctcgccggactcgtcgtcgtacgacgggtcctcttgctgcttcggcttcgcggacgtgtcggagccggtgacgccgagcgacgcggcgtcgggggcggcagaagcggcggccgcggcggcggcggcgacggcggagcacgggaaggaggaggaggccgcggctgcggtggcgagggggaagcactacaggggggtgaggcagcggccgtggggcaagttcgcggcggagatccgggaccccgccaagaacggcgcgcgcgtgtggctcggcacgttcgacaccgccgaggacgccgccctggcgtacgaccgcgccgcctaccgcatgcgtggctcccgcgcgctcctcaacttcccgctccgcatcggctcggagatcgcagccgccgccgccgccgcagcggcagcggcagccggcgacaagcggccgtcgccggagccggcgacctcggagtcgtccttctcctcctcatcctcctgcaccaccaccaccacctcctcctcaacctcctcctccggctccccgaaacggagaaagagaggcgaggccgcggccgcgtccatgtccatgcccctggtgcccccgccttcccagctgaactggccggtgcaggcatggtaccccgccgccgcaccggtcgagcaggtggcgatcaccccgcgcgtggagcagctcgtcatctaa</cdnaseq>

Protein Sequence

<aaseq>MTARSMLRNHPEASVLDTIRQHLLEEPRGGGGGEAAEASFGSLV ADMWSDSLPFRDDDADDMVVFGAMRDAFSCGWLPDGVFAEVKPEPLLSPDSSSYDGSS CCFGFADVSEPVTPSDAASGAAEAAAAAAAATAEHGKEEEAAAAVARGKHYRGVRQRP WGKFAAEIRDPAKNGARVWLGTFDTAEDAALAYDRAAYRMRGSRALLNFPLRIGSEIA AAAAAAAAAAAGDKRPSPEPATSESSFSSSSSCTTTTTSSSTSSSGSPKRRKRGEAAA ASMSMPLVPPPSQLNWPVQAWYPAAAPVEQVAITPRVEQLVI</aaseq>

Gene Sequence

<dnaseqindica>86..1042#accattcaactcgaacacaccacacactgaagtgtgtaaccaagtttgagacagaggcgaggtcgggtcagcaaggaagacggcgatgacggcgcgaagcatgttgcggaaccacccggaggcgtcggtgctcgacaccatccggcagcacctgctggaggagccgcgcggcggcggcggtggcgaggcggcggaggcgagcttcgggagcctggtggccgacatgtggagcgactcgctgccgttccgcgacgacgacgccgacgacatggtggtgttcggcgcgatgcgggacgcgttctcgtgcgggtggctgcccgacggcgtgttcgcggaggtgaagccggagcccctgctctcgccggactcgtcgtcgtacgacgggtcctcttgctgcttcggcttcgcggacgtgtcggagccggtgacgccgagcgacgcggcgtcgggggcggcagaagcggcggccgcggcggcggcggcgacggcggagcacgggaaggaggaggaggccgcggctgcggtggcgagggggaagcactacaggggggtgaggcagcggccgtggggcaagttcgcggcggagatccgggaccccgccaagaacggcgcgcgcgtgtggctcggcacgttcgacaccgccgaggacgccgccctggcgtacgaccgcgccgcctaccgcatgcgtggctcccgcgcgctcctcaacttcccgctccgcatcggctcggagatcgcagccgccgccgccgccgcagcggcagcggcagccggcgacaagcggccgtcgccggagccggcgacctcggagtcgtccttctcctcctcatcctcctgcaccaccaccaccacctcctcctcaacctcctcctccggctccccgaaacggagaaagagaggcgaggccgcggccgcgtccatgtccatgcccctggtgcccccgccttcccagctgaactggccggtgcaggcatggtaccccgccgccgcaccggtcgagcaggtggcgatcaccccgcgcgtggagcagctcgtcatctaaagcgcgcgacgcacagtgaagcaagcaaaccaagccagcaatggtcgacgtcatatcaccttgacgccccaacggattgaccagcgagcacgagccagccattgctttgcacggcgcgagacggcaaagggatcaggcgatggaaccccgtgagcgcgacggcgcaagcgagcagcatccccgcgaaagctccaccggatgcaaaattgcaaacgcgataagctcgcgggtgcaactggtgaaattgggtggtgcaatcgtgtgtgggcgagctctagcagatagtagcgtggtggtggtggtggtattgttgtcccggcgcaactcgcccaagtgggggggtgaggaggatactctgtgtctactagcgtgttcttgtcagggaatgcacggtgtcgtcaagtgtgcaaatcctaagggtcataattcgcgtcattgtcactagtggatcacccgagtgagtttgtgagggtttcagtgaaaaaaaaaaactgtacaaacgatgtcttgtggtgtggagaagcagcagagatgaagaacaatcaatcatcccctttgttcttt</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0546800, RefSeq:Os04g0546800