Difference between revisions of "Os09g0456200"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 7: Line 7:
 
The phytohormone abscisic acid (ABA) plays an essential role in plant adaption to drought stress.When stress was sensed by plants, the ABA level was elevated, which consequently activated the ABA response genes. A major group of transactivation factors binding to ABREs (ABA responsive elements) were basic leucine zipper proteins (bZIPs) that contained basic regions for DNA binding and leucine zipper regions for dimerization(Kim et al. 1997; Uno et al. 2000; Choi et al. 2000)
 
The phytohormone abscisic acid (ABA) plays an essential role in plant adaption to drought stress.When stress was sensed by plants, the ABA level was elevated, which consequently activated the ABA response genes. A major group of transactivation factors binding to ABREs (ABA responsive elements) were basic leucine zipper proteins (bZIPs) that contained basic regions for DNA binding and leucine zipper regions for dimerization(Kim et al. 1997; Uno et al. 2000; Choi et al. 2000)
 
Yeast one hybrid experiment in this study showed that OsbZIP72 could specifically bind to ABRE element.This result indicated that OsbZIP72 could bind to the ABRE in promoters of the down stream genes and was involved in the ABA signaling pathway.
 
Yeast one hybrid experiment in this study showed that OsbZIP72 could specifically bind to ABRE element.This result indicated that OsbZIP72 could bind to the ABRE in promoters of the down stream genes and was involved in the ABA signaling pathway.
 +
In vivo analysis of TRAB1 showed that it could transactivate the downstream reporter genes in response to ABA application (Hobo et al. 1999).
  
 
===Expression===
 
===Expression===

Revision as of 01:53, 5 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. OsbZIP72 was an important regulator in abiotic stress response and ABA signaling transduction pathway(Guojun et al.2009)。 The phytohormone abscisic acid (ABA) plays an essential role in plant adaption to drought stress.When stress was sensed by plants, the ABA level was elevated, which consequently activated the ABA response genes. A major group of transactivation factors binding to ABREs (ABA responsive elements) were basic leucine zipper proteins (bZIPs) that contained basic regions for DNA binding and leucine zipper regions for dimerization(Kim et al. 1997; Uno et al. 2000; Choi et al. 2000) Yeast one hybrid experiment in this study showed that OsbZIP72 could specifically bind to ABRE element.This result indicated that OsbZIP72 could bind to the ABRE in promoters of the down stream genes and was involved in the ABA signaling pathway.

In vivo analysis of TRAB1 showed that it could transactivate the downstream reporter genes in response to ABA application (Hobo et al. 1999).

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os09g0456200

Description

Similar to BZIP transcription factor ABI5

Version

NM_001069897.1 GI:115479536 GeneID:4347257

Length

3914 bp

Definition

Oryza sativa Japonica Group Os09g0456200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:17843808..17847721

Sequence Coding Region

17843880..17844830,17845124..17845195,17846037..17846066,17847106..17847183

Expression

GEO Profiles:Os09g0456200

Genome Context

<gbrowseImage1> name=NC_008402:17843808..17847721 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:17843808..17847721 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgctgacggataggtggggagggaggagggaggcgatggagttcgggaacggcgggtcctcctcgtcggagcgcagggcggcggcggagggggcgacgctggcgagacagggttcggtgtattcgctgacgttcgacgagttccagagcgcgctcgctggtggcggcggcggcggcggtggtggaagcgggttcgggaaggacttcggctccatgaacatggacgagctgctccggagcatctggaccgcggaggagagccaggccatggcctccgcctctggctccgccgcgggggtgggcgtggccgtgggggcgccgccgacgtcgctgcagcgccagggctcgctcaccctgccccgcacgctcagcgccaagacggtggacgaggtatggcgcaaccttgtgcgcgacgagccaccgccggtgggggcggcggatggcggcgatatgccaccccagcggcagtcgaccctcggggagatgaccctggaggagttcttggtcagagccggcgtggtccgagaaaatccacccgctgcgccgccccccgttcccccgccaatgccgccgcggccagtcccggtggtccccaagaccactgccttcttgggaaacttccccggtgccaacgatgccggcgcggcggcgctgggctttgcgccgctcggcatgggggatccagccttgggcaatggcctgatgcccagggcagtgccagtgggcttgcctggcgccgccgtcgctatgcaaacagcggtgaaccagtttgattctggcgataaggggaacagcgacctgtcatcgccgacggagccaatgccttattccttcgaagggttggtgagggggagaaggaacggtggcggagtagagaaagtggtggagaggaggcagaggaggatgatcaagaacagggagtccgcggcgagatcccgcgcgcgcaagcaggcttacacattggaattggaagctgaagttcagaaactcaaggagatgaacaaggaattggagaggaaacaggcagatatcatggaaatgcagaaaaatgaggtagaagaaatgataaaggatccatttggaagaaggaagagactttgcttgcgaagaacactgactggtccctggtga</cdnaseq>

Protein Sequence

<aaseq>MLTDRWGGRREAMEFGNGGSSSSERRAAAEGATLARQGSVYSLT FDEFQSALAGGGGGGGGGSGFGKDFGSMNMDELLRSIWTAEESQAMASASGSAAGVGV AVGAPPTSLQRQGSLTLPRTLSAKTVDEVWRNLVRDEPPPVGAADGGDMPPQRQSTLG EMTLEEFLVRAGVVRENPPAAPPPVPPPMPPRPVPVVPKTTAFLGNFPGANDAGAAAL GFAPLGMGDPALGNGLMPRAVPVGLPGAAVAMQTAVNQFDSGDKGNSDLSSPTEPMPY SFEGLVRGRRNGGGVEKVVERRQRRMIKNRESAARSRARKQAYTLELEAEVQKLKEMN KELERKQADIMEMQKNEVEEMIKDPFGRRKRLCLRRTLTGPW</aaseq>

Gene Sequence

<dnaseqindica>73..1023#1317..1388#2230..2259#3299..3376#gactcgtggcgatcctgagcttctttgggcgtcgaattcctgtggtgcgcggccggcgtggtgcgttgcttgatgctgacggataggtggggagggaggagggaggcgatggagttcgggaacggcgggtcctcctcgtcggagcgcagggcggcggcggagggggcgacgctggcgagacagggttcggtgtattcgctgacgttcgacgagttccagagcgcgctcgctggtggcggcggcggcggcggtggtggaagcgggttcgggaaggacttcggctccatgaacatggacgagctgctccggagcatctggaccgcggaggagagccaggccatggcctccgcctctggctccgccgcgggggtgggcgtggccgtgggggcgccgccgacgtcgctgcagcgccagggctcgctcaccctgccccgcacgctcagcgccaagacggtggacgaggtatggcgcaaccttgtgcgcgacgagccaccgccggtgggggcggcggatggcggcgatatgccaccccagcggcagtcgaccctcggggagatgaccctggaggagttcttggtcagagccggcgtggtccgagaaaatccacccgctgcgccgccccccgttcccccgccaatgccgccgcggccagtcccggtggtccccaagaccactgccttcttgggaaacttccccggtgccaacgatgccggcgcggcggcgctgggctttgcgccgctcggcatgggggatccagccttgggcaatggcctgatgcccagggcagtgccagtgggcttgcctggcgccgccgtcgctatgcaaacagcggtgaaccagtttgattctggcgataaggggaacagcgacctgtcatcgccgacggagccaatgccttattccttcgaagggttggtgagggggagaaggaacggtggcggagtagagaaagtggtggagaggaggcagaggaggatgatcaagaacagggagtccgcggcgagatcccgcgcgcgcaagcaggtcttaaactctaaattctttgtactgattatgcatctattgctattggaaccattctgtgagagtgccaagttgttgagcctacctcaaaataagatgatagaaatactattggcagtaacttagtttactggagtttcccatggcatgctaatcttagcaactataatcaaactttgtgttatatgagcagagctgttggctagtttgttcatccctgttatggattttgtttaaaagcagataatttcatcaaatttcctgtcttgctaacaatttccttattggaaaaggcttacacattggaattggaagctgaagttcagaaactcaaggagatgaacaaggaattggagaggaaacaggtttctttctgacaaactctgttgtagaatgttgaatggactattagcacatgattaattaagttttaattattacaaacttgacaaatggatatatttgatattttaaaataacttctatatagaaagttttcccacgaaacacaccgtttagcggtttgaaaagcgtgctaacggaaactgaggtaaaatttgtatagtctcctttcagtataaagaacaaggcctacttttagtatagtctccttaagaaggatttatactgctgttctaaaactcgtagcttcagttcttaaaccccagtattagctgctttgcttctctgttcatgttcatgacatcagagggttcaaacagggttcactatgacttgctctttcgaagtaatgcatatgtttctcagaaacaaagcccattgtgtccaacattgagtttctcttttagaataatcttccaatgttgctgcagtaatagtttcaattccttgtctaggaagaaaatttttttcatatctgacatgatgccaacagccctgttgcctacgtacacaaaacgcatattacccagcttgcacttcttataaatgattggtgaacatgtcggtaaattagggctcaagtatcatacttgaagtttatcatttttatagactttttttttattccagtctatgcggaaagcatgcaatcaaccatctattattacaaaattttagggctttatccataggctaccgaccaatgctagcaaatagcactcgtttacagaattcaaagtttggatatgctcatagcgtactcctttgagagtcctgatattttctttttcttccatcttgcaggcagatatcatggaaatgcagaaaaatgaggtaattgctttcgtcgtttgtttatgtcaaatgtgtgcccttgacacttttctctgtttttacagttacaactataataaatgtcaagataacgctatgtgctgtctgcttaattttttactatgtttttagcttaatttcatttcactttctgttgttcgcataatttagtctgaggttggaatgctggatgtgcatttgtgggacaaatgcttcaatacttacaagttacaacacaaatatttcgcacatgtaaactttgcattctctttcaggttattgcctacagatgctatcttccagttcgtttgttgaattgttgtccattctttttgtttcaaaacatttatttttaggtgttatgcttcttgtattcattacatgaagaaaaatctaggtcatttgctgctttcagttaaaacccttgcttctcattgtatgcacaagtatttttacatgctagcttattcgtgttctcattttctcattagtagactactttttatctcgtgtgtttttcatggcactatatgatggattttttttgacataatatatgatggaatttttattaattcttctttctctaatcaaaccatctcatattaatttggtaatttgtggaatccagtcctttttccttattttggtgtggattgtgctcatttctaagaacagagtagttgtgtagctgcagaatttctttatttctggtatatttacatatggttagctaaatttcatgaaaaacattttctgattttcagtactctctgaaaactactattatggtacaatgttatttgcagtttttctcgagccaatatctcccaagaactggagaaaaaattacttagtgattagcattattatccaaatcatagggttttgagcgtcgactcttgcaaaattcaacttccagtaccataccatttcattcagtattcagcgaacctgcttgtcagaaaaaaagtgtggaacgggtattttatcgtattttacctgtgtaactgcttaaattttgtttcactgcttataggtagaagaaatgataaaggatccatttggaagaaggaagagactttgcttgcgaagaacactgactggtccctggtgatgacgagtggtcgatggcatgcaaattcccaccttcatcagcgactgtgcataatttaatctgttgtaaaccaatggtggacgaacttgtgcttgattaatcttctagtttcatttttcctgctagctgattctgagaaggcttccaaaactgacatgtagattatgtgtagacgaatgaagctgtcagaacaacttcctgtaatccttgagaaaacttgtatagtgttgtctaggtttgtatcatgctagtctttctatctagtgtcccaccctagagaccagacatcttggatgagttcagaggtcgatttaagcaagtcatggggaccaagaatcatactgcaacctgcctgatgactagctaagctaggtagtatgtagcaatatctgatatctgtacctgcttcctgaagtatgtattgttatctagtgtatctgatatctagcgtgtaaactgtaaaggagtataagcagacctagttctcaagaaaaaaaagtataagcagacctactaattgcttataagcctgttactt</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0456200, RefSeq:Os09g0456200