Difference between revisions of "Os06g0134466"

From RiceWiki
Jump to: navigation, search
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
Please input function information here.
 
Please input function information here.
 +
With the completion of the rice genome sequencing,a standardized annotation is necessary so that the information from the genome sequence can be fully utilized in understanding the biology of rice and other cereal crops. An annotation jamboree was held in Japan with the aim of annotating and manually curating all the genes in the rice genome. Here we present the Rice Annotation Project Database(RAP-DB), which has been developed to provide access to the annotation data. The RAP-DB has two different types of annotation viewers, BLAST and
 +
BLAT search, and other useful features. By connect- ing the annotations to other rice genomics data, such as full-length cDNAs and Tos17 mutant lines, the RAPDB serves as a hub for rice genomics. All of the resources can be accessed through.
  
 
===Expression===
 
===Expression===

Revision as of 02:41, 5 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. With the completion of the rice genome sequencing,a standardized annotation is necessary so that the information from the genome sequence can be fully utilized in understanding the biology of rice and other cereal crops. An annotation jamboree was held in Japan with the aim of annotating and manually curating all the genes in the rice genome. Here we present the Rice Annotation Project Database(RAP-DB), which has been developed to provide access to the annotation data. The RAP-DB has two different types of annotation viewers, BLAST and BLAT search, and other useful features. By connect- ing the annotations to other rice genomics data, such as full-length cDNAs and Tos17 mutant lines, the RAPDB serves as a hub for rice genomics. All of the resources can be accessed through.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os06g0134466

Description

Hypothetical protein

Version

NM_001187657.1 GI:297724444 GeneID:9272651

Length

3906 bp

Definition

Oryza sativa Japonica Group Os06g0134466, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:1848994..1852899

Sequence Coding Region

1851766..1852123,1852586..1852812

Expression

GEO Profiles:Os06g0134466

Genome Context

<gbrowseImage1> name=NC_008399:1848994..1852899 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:1848994..1852899 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgtccaggagagcagggcgggagcgggacccatgtgcggatggggtatcccgatcccccttcacggatgaggacgtacgagtgtacagcgattctcgtgggtatttctcctccggggggcgcgatgatgatgccgggccattcccaacctccgatgaactctaccaccactatcgcccccggacgacgcccagtgatccagtcccgccgccgctttcttcacagtgctcttatcctgaatctgcacatgcactgcaagaaccagatgttttgtccttgggaaagcttcttgatgctacaacattgaaagaatcaatcacttgcagtccctcttcctccccgcaggccgtatcaaaagacaccatcaactcttcaccatcagtccgttgcctttcctcccctgggtcaatcatttgggttcgggaacctcctgaagaccgccttggggtataccacattcggatggatcgtagtgggtcattccacatgtatcctgatctgggtggtccatttcagagcttgaatgaagctcaagatgctatcagcagccatcttaacaggatttatccaccagtaaagtaa</cdnaseq>

Protein Sequence

<aaseq>MASRRAGRERDPCADGVSRSPFTDEDVRVYSDSRGYFSSGGRDD DAGPFPTSDELYHHYRPRTTPSDPVPPPLSSQCSYPESAHALQEPDVLSLGKLLDATT LKESITCSPSSSPQAVSKDTINSSPSVRCLSSPGSIIWVREPPEDRLGVYHIRMDRSG SFHMYPDLGGPFQSLNEAQDAISSHLNRIYPPVK</aaseq>

Gene Sequence

<dnaseqindica>777..1134#88..314#atttcgattccaccaagccctagtccccgccacgccaccgtccgccggcgacgcccccaccgccggccggaggcgccatccccatccatggcgtccaggagagcagggcgggagcgggacccatgtgcggatggggtatcccgatcccccttcacggatgaggacgtacgagtgtacagcgattctcgtgggtatttctcctccggggggcgcgatgatgatgccgggccattcccaacctccgatgaactctaccaccactatcgcccccggacgacgcccagtgatccagtcccgccgccgctttcttcacagtacgaacacctcccttcgcttatctgtttcttattatatctcgagggcatatattttccctgtggaggtttgtgaaagttagtggatttcgattcaatcgattgcttttttttgtgaagattgcttctcccagaaggggaaaccaggactaggagaatattgatcagtagaacttgatatctggggaagggtagggaagagaggggagggagggttgtcaattttgacaagttttacaaaaaggtcaaattgtcaatttttcggataaattggtgtgtaacatatgtgcatttctacaaaccaaatgttgtaacttggttaaagactatacatttcctagtgtgttatcctcggatttgcacaatgatccttctagaatatcagctttgtaagataaactgtttgactgaatatcaactttttaagataaattgtttgactcattgatcttgctactgtaggtgctcttatcctgaatctgcacatgcactgcaagaaccagatgttttgtccttgggaaagcttcttgatgctacaacattgaaagaatcaatcacttgcagtccctcttcctccccgcaggccgtatcaaaagacaccatcaactcttcaccatcagtccgttgcctttcctcccctgggtcaatcatttgggttcgggaacctcctgaagaccgccttggggtataccacattcggatggatcgtagtgggtcattccacatgtatcctgatctgggtggtccatttcagagcttgaatgaagctcaagatgctatcagcagccatcttaacaggatttatccaccagtaaagtaaggttcttacactctattgtagctaacgctgtttatttcccctgtgcttggatggtgttcagatcatgaatcacaaaatgtaactgtaggacctaacttgtagtttgtactgttcactggctgataaaaagaaatattttgctaagtgatgaaagcaattgagcaagcgaacagttttaggtaactatgtttttaagaggttgttaagcacaaatgactgcaacaaaaagatattatgaagttcagaagttgataaggcctaagctagttgttgcttggtaagcatcatttaggcatgttcccctcagttttttttttgttttttgagaaagagagaaaaaaacctttcccatttaaattactgaaacgcatatattttatatgttcccctcaggttaaaatgttgcaattgattcccaaaccatggtggttcatatcaaaattgtagtttggttatttcttatcctcacagatacatagaagtgatctgttttgtcaaagcagcatccagacaagtctttacagcatttctggtcaaaactgcattatacaacttaaccattcacatagcgttatttcacatgcagttcggacttaaactgcattatagaactttgtaacaagactacaagagtgtgggtcaaatcctgtagcttacctcatttctcaagcagacacagggtgctcctccttcgcctcatttgctgcagttgcattcacctctttagacgcttgcagcagttgatcatgggatgagccctcttcttcacctgcctccacttgagctgaactatttctgaatttatattaggtcctgtttttatatgatccatagtgaataatggcggttccagttggatcacattattctagttcctatctaggaatagatagcttgtttcccagctagctttgatgtgccagaggctaagtgtgattccacggcacttacgtatacctttcaaattatgaagttttgtgcttcttctatgttgataactgcgaaattatgctagtgttttgttgtttcaaatcatatgcatgttgaactttctattagataacatttacacattctctaaacattgaactaaattgctggtacacattctctaacaatgcctttgcaacccccacattgtactatattcattgtgccttgtactaatgatatagtctgatctgatctgagttaggttccaagagcgacctggggagtcatatgtggacaggatgataagggaaaagctttattggcctgatggcactaggaagaaatgttccaaagcacaggcatttgagaatgtcaaaaatatgatgaatcaactagctaaggtgatattagacatgtataatgatgatcaaaattttttggaggtttgttcttgctctcgctttatgtctatcattctcgctttggtggtgtctaattgatgtcacacttgccgatcttattctatttctcattgtaggatctttcctatgagcttaaagaggtcgttagcttcgaaccaatatttgagagtcataggtggtttgatcatataaatttcactgcaaacactaaaggatctaaagggctagatcgtgaccatctattctttgctgaagcaatgtctctagaaggacaaaaggattatgtggtcacttgctgctctttgataagttctaatgacaatggtaagctgtacccgtcttaacttttgtggacttgggttcatacttcataatttgtatatactcataaacctgggagaaacatttggtttttcatgtttaataatctgttttttcatagcttcttgcattttttttccttttaccttcattagctcaacttgaatttaagatattttcatatatataattgctgcctaactgaataactgatggtgtgtctgtcatttgacgaaacgatctatttctttctaaggtaactgctatacctgcaagtttgggaacagaagtatgaagcacccaaatgatgtcaattcatatgttggcggccactgttatatcactgggatatatgacactgaagtgtcgagtgactctgaagaggtcagaggatccatcttttcctccttattttcattaatgcatatactgcgcttcattgtgaatgacatgttttctgccactggattgacaggatgaggatgcagaggaacagaggttaagaaaaatgtatcaggtatatccgtatatgtcatgtttctggctgagtatgtgttctttttctcaattaatgttgattgctctctcgtgtttttcttaggatcttgatgatccaggtgtatgggaagagctctttgattgagatcatgtcagttgcaactggaacggatttataattaacatattttatgccatgcaaccatgttagtgacacagttttctgccccttgattgacaggacgaggatgcagaggagcaaaggctaagaaaaatgtatcaggtacgcgaccttatttcagacatagcgttattatatgcatacagtatagtgtctttttttttcttctcaaaattgatgattgctctctaatgtttttcttaggatcttgatgacccaggtgtgtgggaagagctttttggttgaggtcatgtcagttgcaacatggagggtgcaatataactagactgttttataattaacataatgttatacaatgttactattttttatctggattgttgccaggaaccagggaccaaatgcacctggaaccttaacttgacttttggcttagaggctacctacttgggatcc</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0134466, RefSeq:Os06g0134466