Difference between revisions of "Os01g0172400"

From RiceWiki
Jump to: navigation, search
(References)
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
Please input function information here.
 
Please input function information here.
PLDα occupies a critical step in controlling stomatal movements and plant response to water stress. <ref name = “ref1”/>PLDα is the common plant PLD that does not require phosphatidylinositol 4, 5-bisphosphate (PIP2) for activity, when assayed at millimolar concentrations of Ca2+. <ref name=”ref5”/>
+
PLDα occupies a critical step in controlling stomatal movements and plant response to water stress.<ref name = “ref1”/> PLDα is the common plant PLD that does not require phosphatidylinositol 4, 5-bisphosphate (PIP2) for activity, when assayed at millimolar concentrations of Ca2+.<ref name=”ref5”/>  
PLDα1 promotes abscisic acid (ABA)-induced stomatal closure and regulates ABA-inhibited stomatal opening. <ref name = “ref1”/>, <ref name = “ref2”/>, <ref name = “ref3”/>.OsPLDα1 regulates salt tolerance in rice by activating H+-ATPase activity and transcription in tonoplast and plasma membrane. We also found that OsPLDα1 is important to transiently activate OsCDPK7 transcription in response to NaCl stress. <ref name=”ref4”/>
+
PLDα1 promotes abscisic acid (ABA)-induced stomatal closure and regulates ABA-inhibited stomatal opening.<ref name = “ref1”/>, <ref name = “ref2”/>, <ref name = “ref3”/>.OsPLDα1 regulates salt tolerance in rice by activating H+-ATPase activity and transcription in tonoplast and plasma membrane. We also found that OsPLDα1 is important to transiently activate OsCDPK7 transcription in response to NaCl stress.<ref name=”ref4”/>
  
 
===Expression===
 
===Expression===

Revision as of 04:02, 5 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. PLDα occupies a critical step in controlling stomatal movements and plant response to water stress.[1] PLDα is the common plant PLD that does not require phosphatidylinositol 4, 5-bisphosphate (PIP2) for activity, when assayed at millimolar concentrations of Ca2+.[2] PLDα1 promotes abscisic acid (ABA)-induced stomatal closure and regulates ABA-inhibited stomatal opening.[1], [3], [4].OsPLDα1 regulates salt tolerance in rice by activating H+-ATPase activity and transcription in tonoplast and plasma membrane. We also found that OsPLDα1 is important to transiently activate OsCDPK7 transcription in response to NaCl stress.[5]

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here. [1] [6] [7] [5] [2]

Structured Information

Gene Name

Os01g0172400

Description

Phospholipase D alpha 1 precursor (EC 3.1.4.4) (PLD alpha 1) (Choline phosphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1)

Version

NM_001048688.1 GI:115434789 GeneID:4327647

Length

4181 bp

Definition

Oryza sativa Japonica Group Os01g0172400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:3723613..3727793

Sequence Coding Region

3723983..3724416,3724895..3726791,3727332..3727439

Expression

GEO Profiles:Os01g0172400

Genome Context

<gbrowseImage1> name=NC_008394:3723613..3727793 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:3723613..3727793 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgcagatgctgctccatgggacgctgcacgccaccatcttcgaggcggcgtcgctctccaacccgcaccgcgccagcggaagcgcccccaagttcatccgcaagtttgtggaggggattgaggacactgtgggtgtcggcaaaggcgccaccaaggtgtattctaccattgatctggagaaagctcgtgtagggcgaactaggatgataaccaatgagcccatcaaccctcgctggtatgagtcgttccacatctattgcgctcatatggcttccaatgtgatcttcactgtcaagattgataaccctattggggcaacgaatattgggagggcttacctgcctgtccaagagcttctcaatggagaggagattgacagatggctcgatatctgtgataataaccgcgagcctgttggtgagagcaagatccatgtgaagcttcagtacttcgatgtttccaaggatcgcaattgggcgaggggtgtccgcagtaccaagtatccaggtgttccttacaccttcttctctcagaggcaagggtgcaaagttaccttgtaccaagatgctcatgtcccagacaacttcattccaaagattccgcttgccgatggcaagaattatgaaccccacagatgctgggaggatatctttgatgctataagcaatgctcaacatttgatttacatcactggctggtctgtatacactgagatcaccttggttagggactccaatcgtccaaaacctggaggggatgtcacccttggggagttgctcaagaagaaggccagtgaaggtgttcgggtcctcatgcttgtgtgggatgacaggacttcagttggtttgctaaagagggatggcttgatggcaacacatgatgaggaaactgaaaattacttccatggctctgacgtgaactgtgttctatgccctcgcaaccctgatgactcaggcagcattgttcaggatctgtcgatctcaactatgtttacacaccatcagaagatagtagttgttgaccatgagttgccaaaccagggctcccaacaaaggaggatagtcagtttcgttggtggccttgatctctgtgatggaaggtatgacactcagtaccattctttgtttaggacactcgacagtacccatcatgatgacttccaccagccaaactttgccactgcatcaatcaaaaagggtggacctagagagccatggcatgatattcactcacggctggaagggccaatcgcatgggatgttctttacaatttcgagcagagatggagaaagcagggtggtaaggatctccttctgcagctcagggatctgtctgacactattattccaccttctcctgttatgtttccagaggacagagaaacatggaatgttcagctatttagatccattgatggtggtgctgcttttgggttccctgatacccctgaggaggctgcaaaagctgggcttgtaagcggaaaggatcaaatcattgacaggagcatccaggatgcatacatacatgccatccggagggcaaagaacttcatctatatagagaaccaatacttccttggaagttcctatgcctggaaacccgagggcatcaagcctgaagacattggtgccctgcatttgattcctaaggagcttgcactgaaagttgtcagtaagattgaagccggggaacggttcactgtttatgttgtggtgccaatgtggcctgagggtgttccagagagtggatctgttcaggcaatcctggactggcaaaggagaacaatggagatgatgtacactgacattacagaggctctccaagccaagggaattgaagcgaaccccaaggactacctcactttcttctgcttgggtaaccgtgaggtgaagcaggctggggaatatcagcctgaagaacaaccagaagctgacactgattacagccgagctcaggaagctaggaggttcatgatctatgtccacaccaaaatgatgatagttgacgatgagtacatcatcatcggttctgcaaacatcaaccagaggtcgatggacggcgctagggactctgagatcgccatgggcgggtaccagccataccatctggcgaccaggcaaccagcccgtggccagatccatggcttccggatggcgctgtggtacgagcacctgggaatgctggatgatgtgttccagcgccccgagagcctggagtgtgtgcagaaggtgaacaggatcgcggagaagtactgggacatgtactccagcgacgacctccagcaggacctccctggccacctcctcagctaccccattggcgtcgccagcgatggtgtggtgactgagctgcccgggatggagtactttcctgacacacgggcccgcgtcctcggcgccaagtcggattacatgccccccatcctcacctcatag</cdnaseq>

Protein Sequence

<aaseq>MAQMLLHGTLHATIFEAASLSNPHRASGSAPKFIRKFVEGIEDT VGVGKGATKVYSTIDLEKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKID NPIGATNIGRAYLPVQELLNGEEIDRWLDICDNNREPVGESKIHVKLQYFDVSKDRNW ARGVRSTKYPGVPYTFFSQRQGCKVTLYQDAHVPDNFIPKIPLADGKNYEPHRCWEDI FDAISNAQHLIYITGWSVYTEITLVRDSNRPKPGGDVTLGELLKKKASEGVRVLMLVW DDRTSVGLLKRDGLMATHDEETENYFHGSDVNCVLCPRNPDDSGSIVQDLSISTMFTH HQKIVVVDHELPNQGSQQRRIVSFVGGLDLCDGRYDTQYHSLFRTLDSTHHDDFHQPN FATASIKKGGPREPWHDIHSRLEGPIAWDVLYNFEQRWRKQGGKDLLLQLRDLSDTII PPSPVMFPEDRETWNVQLFRSIDGGAAFGFPDTPEEAAKAGLVSGKDQIIDRSIQDAY IHAIRRAKNFIYIENQYFLGSSYAWKPEGIKPEDIGALHLIPKELALKVVSKIEAGER FTVYVVVPMWPEGVPESGSVQAILDWQRRTMEMMYTDITEALQAKGIEANPKDYLTFF CLGNREVKQAGEYQPEEQPEADTDYSRAQEARRFMIYVHTKMMIVDDEYIIIGSANIN QRSMDGARDSEIAMGGYQPYHLATRQPARGQIHGFRMALWYEHLGMLDDVFQRPESLE CVQKVNRIAEKYWDMYSSDDLQQDLPGHLLSYPIGVASDGVVTELPGMEYFPDTRARV LGAKSDYMPPILTS</aaseq>

Gene Sequence

<dnaseqindica>3378..3811#1003..2899#355..462#agtctctcttctcccgcaattttataatctcgctcgatccaatctgctccccttcttcttctactctccccatctcggctctcgccatcgccatcctcctctcccttcccggagaagacgcctccctccgccgatcaccacccggtaagcccagtgtgcttaggctaagcgcactagagcttcttgctcgcttgcttcttctccgctcagatctgcttgcttgcttgcttcgctagaaccctactctgtgctgcgagtgtcgctgcttcgtcttccttcctcaagttcgatctgattgtgtgtgtgggggggcgcaggtagggcgaggagggagccaaatccaaatcagcagccatggcgcagatgctgctccatgggacgctgcacgccaccatcttcgaggcggcgtcgctctccaacccgcaccgcgccagcggaagcgcccccaagttcatccgcaaggttcggacccttctccttaatctactcgtctttgctcttgctctttttcttttttgtccctttcttgtgtgtgcgtttgcatgagcccgaatttgatctgctagtgcacagtacagtcagatacactgaaacgatctggaaattctggattattaggaaaaataaagaggtagtagacaagaattggagatactttctatcaagattggtctattatgcttggccatttcttgtttgacccaagtacttctttgaatctagagtttgctgtgtgtgatgtggtgtgtgtttgtgtcaccaaaaatcttcattagctaaaactgaaattttatttattaactgacctactaaaaatgtagagttctctgtgtgtgatgtgtgcttgtgtcaccaaaaatcttgatttgatagagtttttatttatttattaactgacctactacaaatctattgctgtatgctatgtgtgtctgtatcacctgaaatgcaatgtcttcttctttgttgttcttgatctaacacgtgagctcatgtcaacagtttgtggaggggattgaggacactgtgggtgtcggcaaaggcgccaccaaggtgtattctaccattgatctggagaaagctcgtgtagggcgaactaggatgataaccaatgagcccatcaaccctcgctggtatgagtcgttccacatctattgcgctcatatggcttccaatgtgatcttcactgtcaagattgataaccctattggggcaacgaatattgggagggcttacctgcctgtccaagagcttctcaatggagaggagattgacagatggctcgatatctgtgataataaccgcgagcctgttggtgagagcaagatccatgtgaagcttcagtacttcgatgtttccaaggatcgcaattgggcgaggggtgtccgcagtaccaagtatccaggtgttccttacaccttcttctctcagaggcaagggtgcaaagttaccttgtaccaagatgctcatgtcccagacaacttcattccaaagattccgcttgccgatggcaagaattatgaaccccacagatgctgggaggatatctttgatgctataagcaatgctcaacatttgatttacatcactggctggtctgtatacactgagatcaccttggttagggactccaatcgtccaaaacctggaggggatgtcacccttggggagttgctcaagaagaaggccagtgaaggtgttcgggtcctcatgcttgtgtgggatgacaggacttcagttggtttgctaaagagggatggcttgatggcaacacatgatgaggaaactgaaaattacttccatggctctgacgtgaactgtgttctatgccctcgcaaccctgatgactcaggcagcattgttcaggatctgtcgatctcaactatgtttacacaccatcagaagatagtagttgttgaccatgagttgccaaaccagggctcccaacaaaggaggatagtcagtttcgttggtggccttgatctctgtgatggaaggtatgacactcagtaccattctttgtttaggacactcgacagtacccatcatgatgacttccaccagccaaactttgccactgcatcaatcaaaaagggtggacctagagagccatggcatgatattcactcacggctggaagggccaatcgcatgggatgttctttacaatttcgagcagagatggagaaagcagggtggtaaggatctccttctgcagctcagggatctgtctgacactattattccaccttctcctgttatgtttccagaggacagagaaacatggaatgttcagctatttagatccattgatggtggtgctgcttttgggttccctgatacccctgaggaggctgcaaaagctgggcttgtaagcggaaaggatcaaatcattgacaggagcatccaggatgcatacatacatgccatccggagggcaaagaacttcatctatatagagaaccaatacttccttggaagttcctatgcctggaaacccgagggcatcaagcctgaagacattggtgccctgcatttgattcctaaggagcttgcactgaaagttgtcagtaagattgaagccggggaacggttcactgtttatgttgtggtgccaatgtggcctgagggtgttccagagagtggatctgttcaggcaatcctggactggcaaaggagaacaatggagatgatgtacactgacattacagaggctctccaagccaagggaattgaagcgaaccccaaggactacctcactttcttctgcttgggtaaccgtgaggtgaagcaggctggggaatatcagcctgaagaacaaccagaagctgacactgattacagccgagctcaggaagctaggaggttcatgatctatgtccacaccaaaatgatgataggtaccgagtgagctttatattacatatttgcattcactatgcaatttttgttcatttaaagcatgtcagatgagttacatacttatgtagcatttgttaattttttttaccaagtattgcatttgtctatttattagtttatatgcattgcatatgtcaagctctaagttgaagtcatgcttccctttactcttaaagtaacatctttttagacagaattgtcttctgctctctaaatctgtttctgtttaatacaggtttttatttttaaagaaataatgtcgtattgtaggttatttagctgattttactgttgcattctgtcgttctaaaaagatgaaaatccttttaacaaaagaaataaacaagatcctctaatgatcaagctagtaacttcatctccttattcggtttcttttttctatcaaaaatatacacttattgttcaagctagtaacttcatttcttccattttcagttgacgatgagtacatcatcatcggttctgcaaacatcaaccagaggtcgatggacggcgctagggactctgagatcgccatgggcgggtaccagccataccatctggcgaccaggcaaccagcccgtggccagatccatggcttccggatggcgctgtggtacgagcacctgggaatgctggatgatgtgttccagcgccccgagagcctggagtgtgtgcagaaggtgaacaggatcgcggagaagtactgggacatgtactccagcgacgacctccagcaggacctccctggccacctcctcagctaccccattggcgtcgccagcgatggtgtggtgactgagctgcccgggatggagtactttcctgacacacgggcccgcgtcctcggcgccaagtcggattacatgccccccatcctcacctcatagacgaggaagcactacactacaatctgctggcttctcctgtcagtccttctgtacttcttcagtttggtggcgagatggtatggccgttgttcagaatttcttcagaatagcagttgttacagttgtgaatcataaagtaataagtgcagtatctgtgcatggttgagttgggaagaagatcggggatgcaatgatgcttgtgaagttgtgatgccgtttgtaagatgggaagttgggaactactaagtaattggcatgattgtactttgcactactgtttagcgttgttgatactggttaaccgtgtgttcatctgaacttgattcttgatgcagtttgtggcattaccagtttatcatcgttcttcagg</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0172400, RefSeq:Os01g0172400

  1. 1.0 1.1 1.2 Sang Y, Zhang S, Li W, Huang B, Wang X (2001), Regulation of plant water loss by manipulating the expression of phospholipase Dα. Plant J. 28, 135-144.
  2. 2.0 2.1 Pappan, K. Zheng, S. Wang, X (1997) Identification and characterization of a novel phospholipase D that requires polyphosphoinositides and submicromolar calcium for activity in Arabidopsis. J. Biol. Chem. 272, 7048± 7054.
  3. Cite error: Invalid <ref> tag; no text was provided for refs named .E2.80.9Cref2.E2.80.9D
  4. Cite error: Invalid <ref> tag; no text was provided for refs named .E2.80.9Cref3.E2.80.9D
  5. 5.0 5.1 Shen P, Wang R, Jing W, Zhang W (2011) Rice phospholipase Dα is involved in salt tolerance by the mediation of H+-ATPase activity and transcription. J. Integr. Plant Biol. 53(4), 289 - 299.
  6. Zhang W, Qin C, Zhao J, Wang X (2004) Phospholipase Dα1-derived phosphatidic acid interacts with ABI1 phosphatase 2C and regulates abscisic acid signaling. Proc. Natl. Acad. Sci. USA. 101, 9508 - 9513.
  7. Mishra G, Zhang W, Deng F, Wang X (2006) A bifurcating pathway directs abscisic acid effects on stomatal closure and opening in Arabidopsis. Science 312, 264-266.