Difference between revisions of "Os02g0325600"
Wanguilong (talk | contribs) (→Function) |
|||
| Line 4: | Line 4: | ||
===Function=== | ===Function=== | ||
Please input function information here. | Please input function information here. | ||
| + | the gene encoding a putative GARP-type transcription factor (Os02g0325600) from rice (Oryza sativa L.), which was designated NIGT1 (NitrateI nducible,GARP-type Transcriptional Repressor 1). | ||
| + | NIGT1 is a nitrate-inducible and autorepressible transcriptional repressor which might be | ||
| + | involved in control of nitrate utilization. | ||
| + | The transcriptome analysis of nitrogen response pathways in rice has indicated that several genes encoding putative transcription factors are induced by the supply of ammonium nitrate and also that NIGT1 was one of the earliest and most strongly induced genes. It encodes a novel transcriptional repressor of the regulatory network underlying the nitrate response in rice. | ||
| + | More significantly, the identification of such a transcription factor suggests the presence of a complex mechanism of transcriptional regulation for an appropriate nitrogen response in plants. | ||
| + | NIGT1 is a member of a subgroup for which the DNA binding activity has not been previously reported for any member. the DNA binding activity of NIGT1 in a DNA-binding site selection experiment using a library of randomly synthesized DNA and recombinant NIGT1 | ||
| + | Protein. | ||
| + | '''NIGT1 is a transcriptional repressor''' | ||
| + | The activity of NIGT1 as a transcription factor was examined by co-transfection of various reporter and effector constructs into maize mesophyll protoplasts and measurement | ||
| + | of reporter enzyme activity. The expression of NIGT1 could not activate transcription from the promoter containing four copies of the core-1 sequence or two copies of the core-2 sequence upstream of the 35S minimal promoter, whereas NIGT1 fused to the transcriptional activation | ||
| + | Domain of VP16 (NIGT1¨CVP16) was found to promote transcription from these promoters. | ||
| + | The activity of NIGT1 is a transcription factor. Similar to LexA¨CSUPRD, the expression of LexA¨CNIGT1 fusion protein down-regulated reporter enzyme activity, indicating that NIGT1 is a transcriptional repressor. | ||
===Expression=== | ===Expression=== | ||
Revision as of 04:17, 5 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here. the gene encoding a putative GARP-type transcription factor (Os02g0325600) from rice (Oryza sativa L.), which was designated NIGT1 (NitrateI nducible,GARP-type Transcriptional Repressor 1). NIGT1 is a nitrate-inducible and autorepressible transcriptional repressor which might be involved in control of nitrate utilization. The transcriptome analysis of nitrogen response pathways in rice has indicated that several genes encoding putative transcription factors are induced by the supply of ammonium nitrate and also that NIGT1 was one of the earliest and most strongly induced genes. It encodes a novel transcriptional repressor of the regulatory network underlying the nitrate response in rice. More significantly, the identification of such a transcription factor suggests the presence of a complex mechanism of transcriptional regulation for an appropriate nitrogen response in plants. NIGT1 is a member of a subgroup for which the DNA binding activity has not been previously reported for any member. the DNA binding activity of NIGT1 in a DNA-binding site selection experiment using a library of randomly synthesized DNA and recombinant NIGT1 Protein. NIGT1 is a transcriptional repressor The activity of NIGT1 as a transcription factor was examined by co-transfection of various reporter and effector constructs into maize mesophyll protoplasts and measurement of reporter enzyme activity. The expression of NIGT1 could not activate transcription from the promoter containing four copies of the core-1 sequence or two copies of the core-2 sequence upstream of the 35S minimal promoter, whereas NIGT1 fused to the transcriptional activation Domain of VP16 (NIGT1¨CVP16) was found to promote transcription from these promoters. The activity of NIGT1 is a transcription factor. Similar to LexA¨CSUPRD, the expression of LexA¨CNIGT1 fusion protein down-regulated reporter enzyme activity, indicating that NIGT1 is a transcriptional repressor.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os02g0325600 |
|---|---|
| Description |
Similar to Phosphate starvation response regulator-like protein |
| Version |
NM_001053237.1 GI:115445844 GeneID:4329184 |
| Length |
2131 bp |
| Definition |
Oryza sativa Japonica Group Os02g0325600, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:13125084..13127214 |
| Sequence Coding Region |
13125349..13125484,13125571..13125890,13126002..13126323,13126456..13126532,13126644..13127027 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:13125084..13127214 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:13125084..13127214 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggaggtggaccacgcggaccgcgacggcgcgcggcgccggtgccgcgagtacctgctcgcgctcgaggaggagcgccgcaagatccaggtgttccagcgggagctccctctctgcttcgacctcgtcacccagactatcgaggggatgaggagccagatggacgccgccggcagcgaggagacggtcagcgaccagggcccgccgccggtgctcgaggagttcatcccgctcaagcccagcctctcgctgtcctcctccgaggaggagagcacccacgccgacgccgccaagtcaggcaagaaggaggaggccgagacgtcggagaggcattcgtcgccgccgccgccgccgccggaggccaagaaggtgacgccggattggctccagtccgtgcagctctggagccaagaagaaccccagcagccatcgtctcctagcccaactcctaccaaggatttaccgtgcaagccggtggcgctgaacgccaggaaggccggcggagcgttccagccgttcgagaaggagaagcgcgccgagctgccggcgtcgtcgaccacggccgcggcgagctcgaccgtggtcggagacagcggcgacaagcccaccgatgatgacacggagaaacacatggagacggacaaggacaacgacaaggacgccaaggacaaggacaaggaaggccagtcgcagcctcaccggaagcctcgccggtgctgggcgccggagctccaccgccgcttcctgcaagcgctgcagcagctgggcgggtcccatgtagcgacgcccaagcagatccgggagctgatgaaggtggatggcctcaccaacgacgaggtcaagagccatttgcagaagtatcgtctacacacgaggaggccgagctcgacggggcagagcagcgccgcagccggcgtccccgccccgcctgcgccgcagttcgtcgtcgtcgggagcatctgggtacccccgccggaatacgctgccgcggccgccgcacagcagcacgtgcagcttgccgccgccggcaataatgcgtccgggagcgccaaccccgtgtacgctccggtggcgatgctgccggcaggcttgcagccgcattcgcatcggaagcagcaccagcagcagcagcaaggacagagacattccgggtcggaaggccggcggagcggggacgccggcgatggcagctcgtcctccccggccgtctcgtcgtcgtcgcagaccacctccgcttga</cdnaseq> |
| Protein Sequence |
<aaseq>MEVDHADRDGARRRCREYLLALEEERRKIQVFQRELPLCFDLVT QTIEGMRSQMDAAGSEETVSDQGPPPVLEEFIPLKPSLSLSSSEEESTHADAAKSGKK EEAETSERHSSPPPPPPEAKKVTPDWLQSVQLWSQEEPQQPSSPSPTPTKDLPCKPVA LNARKAGGAFQPFEKEKRAELPASSTTAAASSTVVGDSGDKPTDDDTEKHMETDKDND KDAKDKDKEGQSQPHRKPRRCWAPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLT NDEVKSHLQKYRLHTRRPSSTGQSSAAAGVPAPPAPQFVVVGSIWVPPPEYAAAAAAQ QHVQLAAAGNNASGSANPVYAPVAMLPAGLQPHSHRKQHQQQQQGQRHSGSEGRRSGD AGDGSSSSPAVSSSSQTTSA</aaseq> |
| Gene Sequence |
<dnaseqindica>266..401#488..807#919..1240#1373..1449#1561..1944#ccgtccgttcgattcgacgacaccttcatttttattttcttccttgtgtaataagaagacgactagtggtaacaaaaagattcgctccctacgcgacgccccgaccccgattcccttcgcttcctactccttcctcttccttgttccttccttccttcctcaccccacgaacgcgcacaccaacctttcccatccctagctgctgcccttccatcggatccacggatcgagacctggcacggcggcggaggacgggccggcggagatggaggtggaccacgcggaccgcgacggcgcgcggcgccggtgccgcgagtacctgctcgcgctcgaggaggagcgccgcaagatccaggtgttccagcgggagctccctctctgcttcgacctcgtcacccagagtacgcgcgcgcctcgctcgccacgcattcttcgctcgatcgctgcgcgttcgtgcgcgtgagtgctaattgtgattgtggtgcagctatcgaggggatgaggagccagatggacgccgccggcagcgaggagacggtcagcgaccagggcccgccgccggtgctcgaggagttcatcccgctcaagcccagcctctcgctgtcctcctccgaggaggagagcacccacgccgacgccgccaagtcaggcaagaaggaggaggccgagacgtcggagaggcattcgtcgccgccgccgccgccgccggaggccaagaaggtgacgccggattggctccagtccgtgcagctctggagccaagaagaaccccagcagccatcgtctcctagcccaactcctaccaaggtaattaattaataggttaatttatcagcagatgaaaatgttttcttgctagtttgcactactcttgatctacttttagctaatgcgtcgatctctgatgaactctgccaggatttaccgtgcaagccggtggcgctgaacgccaggaaggccggcggagcgttccagccgttcgagaaggagaagcgcgccgagctgccggcgtcgtcgaccacggccgcggcgagctcgaccgtggtcggagacagcggcgacaagcccaccgatgatgacacggagaaacacatggagacggacaaggacaacgacaaggacgccaaggacaaggacaaggaaggccagtcgcagcctcaccggaagcctcgccggtgctgggcgccggagctccaccgccgcttcctgcaagcgctgcagcagctgggcgggtcccatggttagtgccattttttctcagtgacagctcgaccggacaaaccaaattacattatcctatatcaacaaacagtactgattaatctcgcttgtactagttaattacgagctaattagtcccgtgcttatgcagtagcgacgcccaagcagatccgggagctgatgaaggtggatggcctcaccaacgacgaggtcaagagccatttgcaggtcagcaatggcggacactactttgccctaatttaactcttaacacacgcggataacctgtttactcctctcgatcatgtccttaatttgtgtttcgcttggggttcacagaagtatcgtctacacacgaggaggccgagctcgacggggcagagcagcgccgcagccggcgtccccgccccgcctgcgccgcagttcgtcgtcgtcgggagcatctgggtacccccgccggaatacgctgccgcggccgccgcacagcagcacgtgcagcttgccgccgccggcaataatgcgtccgggagcgccaaccccgtgtacgctccggtggcgatgctgccggcaggcttgcagccgcattcgcatcggaagcagcaccagcagcagcagcaaggacagagacattccgggtcggaaggccggcggagcggggacgccggcgatggcagctcgtcctccccggccgtctcgtcgtcgtcgcagaccacctccgcttgattagtgtagattcgtcgattacatcattatatgtacgtagtacgagagtgcatcacatcaaagtgcagcttgattttggagctagctagcttaaattaagggttaattactgattgcttcgtgatcgcacacaccacatttgctgttttgtttgtaaaaaagataataaaatacataaatattaagg</dnaseqindica> |
| External Link(s) |
