Difference between revisions of "Os01g0609300"

From RiceWiki
Jump to: navigation, search
(Function)
(Expression)
Line 6: Line 6:
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
When there is not stress, ''ospdr9'' is not constitutively expressed in roots as well as in the shoot of rice seedlings. However, a significant amount of ospdr9 transcription can be detected in rice roots by RT-PCR expression analysis after exposing to PEG (13.5 and 15%) within 2 h <ref name="ref2" />. But a 2 h exposure to low or high temperatures (4oC and 42oC) does not induce the expression of ''Ospdr9'' (Fig. 2A). Toxic chemicals, for example, ZnSO4 (2.5 or 5 mM), cobalt and nickel chloride (250 WM and 2.5 mM), markedly induce ospdr9 in rice roots (Fig. 2B); Co generally causes a stronger ''ospdr9'' expression than Ni. Low oxygen stress is a stronger inducer of ''ospdr9'' than salt shock in rice roots, for the expression of ''ospdr9'' induced by salt stress is not only being delayed but also at low levels. It was also suggested that toxic and hypoxic PEG effects were more important than osmotic PEG effects in generating the marked PEG response of ospdr9 <ref name="ref2" />.
 +
In addition, micromolar heavy metals cadmium and zinc concentrations markedly induce ''ospdr9'' in rice roots specifically and rapidly, which may due to the similar mechanism of root-to-shoot metal transport barriers, as observed in Arabidopsis <ref name="ref5" />. DTT (Fig. 6) is stronger inducer of ospdr9 than hydrogen peroxide in rice roots, which suggested a response to redox perturbations that favour the reduced state <ref name="ref2" />. Moreover, the non-thiol antioxidant ascorbic acid also induced ''ospdr9'' in rice roots (Fig. 6). The strong oxidant hydrogen peroxide also induced ospdr9 expression, though at three times lower levels than DTT (Fig. 6), which indicated a response to oxidative conditions as well<ref name="ref2" />.
  
 
===Evolution===
 
===Evolution===

Revision as of 06:06, 5 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Ospdr9 gene locates in chromosome 1 with 21 exons and 20 introns [1]. It is consist of an open reading frame (4371 bp) and a 3’untranslated region (313 bp), including a poly-A tail of 18bp. It encodes a pleiotropic drug resistance (PDR)-type ATP-binding (ABC) protein [2]. There are 15 members in PDR protein subfamily in rice [3], and OsPDR9 protein of 1457 amino acids is predicted to be 163 kDa with a calculated pI of 6.7. Two hydrophilic ABC domains with the length of 150 amino acids compose the full-size ABC transporter protein OsPDR9, and both of the two domains have a well-conserved Walker A motif and less conserved Walker B and ABC signature sequences [4]. According to TMHMM2.0 program, OsPDR9 is predicted to have two hydrophobic integral membrane domains, each with six potential transmembrane-spanning α-helices (TMS).

Expression

When there is not stress, ospdr9 is not constitutively expressed in roots as well as in the shoot of rice seedlings. However, a significant amount of ospdr9 transcription can be detected in rice roots by RT-PCR expression analysis after exposing to PEG (13.5 and 15%) within 2 h [2]. But a 2 h exposure to low or high temperatures (4oC and 42oC) does not induce the expression of Ospdr9 (Fig. 2A). Toxic chemicals, for example, ZnSO4 (2.5 or 5 mM), cobalt and nickel chloride (250 WM and 2.5 mM), markedly induce ospdr9 in rice roots (Fig. 2B); Co generally causes a stronger ospdr9 expression than Ni. Low oxygen stress is a stronger inducer of ospdr9 than salt shock in rice roots, for the expression of ospdr9 induced by salt stress is not only being delayed but also at low levels. It was also suggested that toxic and hypoxic PEG effects were more important than osmotic PEG effects in generating the marked PEG response of ospdr9 [2]. In addition, micromolar heavy metals cadmium and zinc concentrations markedly induce ospdr9 in rice roots specifically and rapidly, which may due to the similar mechanism of root-to-shoot metal transport barriers, as observed in Arabidopsis [5]. DTT (Fig. 6) is stronger inducer of ospdr9 than hydrogen peroxide in rice roots, which suggested a response to redox perturbations that favour the reduced state [2]. Moreover, the non-thiol antioxidant ascorbic acid also induced ospdr9 in rice roots (Fig. 6). The strong oxidant hydrogen peroxide also induced ospdr9 expression, though at three times lower levels than DTT (Fig. 6), which indicated a response to oxidative conditions as well[2].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0609300

Description

PDR-like ABC transporter (PDR3 ABC transporter)

Version

NM_001050074.1 GI:115438435 GeneID:4327728

Length

6852 bp

Definition

Oryza sativa Japonica Group Os01g0609300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:25732000..25738851

Sequence Coding Region

25732258..25732515,25732608..25732862,25732944..25733115,25733193..25733420,25733520..25733653
,25733740..25733823,25733966..25734256,25734334..25734666,25734751..25735001
,25735089..25735355,25735442..25735602,25735713..25736029,25736121..25736402
,25736488..25736789,25736882..25736972,25737061..25737114,25737232..25737308
,25737435..25737594,25737864..25737948,25738156..25738365,25738471..25738832

Expression

GEO Profiles:Os01g0609300

Genome Context

<gbrowseImage1> name=NC_008394:25732000..25738851 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:25732000..25738851 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggacgcggcgggggagatccagaaggtggcgagcatgcggctaggggggagcatgaggggggacagcgggtcgatgtggaggagaggggacgacgtgttctcgaggtcgtcgagggaggaggacgacgaggaggcgctgcggtgggcggcgctcgagaagctgcccacctacgaccgcgtgcgccgcgccatcctgccgctcggtggcgacgacggcgccggggacggaggagggaagggcgtcgtggacgtgcacgggctcggcccgcgcgagcgccgcgcgctcctcgagcgcctcgtgcgcgtcgccgacgaggacaacgagaagttcctcctcaagctcaaggaccgcgtcgaccgggtggggatcgacatgccgacgatcgaggtgcggttcgagcacctggaggcggaggcggaggtccgcgtcggcaacagcggcctccccaccgtcctcaactccatcaccaacaccctcgaggaagccggcaacgcgctcggcattctgcccaaccggaagcagaccatgcccgtcctccacgacgtcagcggcatcatcaagccccgcaggatgactctgctgttaggcccaccggggtcaggcaagaccaccttgctgctcgcgttggccggaaggctcggcaaagatctcaaggcttcaggaaaagtgacctacaacgggcacggcatggaggaattcgtgccggagaggacggcggcttacatcagccagcacgacctccacatcggagagatgaccgtcagggagacacttgccttctcggcacgatgccagggtgttggcagtcgctttgatatgttgactgagctgtcaaggcgagagaaggcagcgaacattaagcctgacgccgatatcgatgcattcatgaaggcggctgcaatgggaggacaggaggcaaacgtgaacactgactatatactgaagatattaggactagagatatgcgctgacacgatggttggggacgagatgctgaggggcatctcaggtgggcaaagaaagcgtgttacgactggtgagatgctggttgggccagccagggcgctcttcatggacgagatctcaactgggcttgacagctccactacattccagatagtgaattcgcttaggcaaactgtccacatcctcggtggcacagctgttatctccctgctgcagccggcgcctgagacttacaacttgtttgatgatatcatcctcctctcagacggtcagattgtgtaccagggcccccgagaggatgtgcttgaattcttcgagtccatggggtttaagtgtcctgacaggaagggtgttgccgacttcttgcaagaagtgacttctaagaaagatcaaaggcagtactgggcgaggcatgacaagccctacaggtttgtgacggttaaggaatttgtgagtgcattccagtcgttccacacagggagagctatagcaaacgaacttgctgttccgtttgataagagtaagagccatcctgccgcactggctaccacaaggtacggtgctcctggcaaggagctgctgaaggcaaatattgacagggagattctcctcatgaagaggaactctttcgtctacatgttcagaaccttccagttgatggtggtgtcactcattgcaatgacactcttcttccgtacgaaaatgaaacgtgattctgtgaccagcgggggcatctacatgggcgcactcttctttggtgtgcttatgatcatgttcaatggtttctcagagcttgcgctcactgtctttaagttgcctgttttcttcaagcagagggatctccttttttatcctgcatggtcgtacactataccctcatggattctcaagatcccaatcacgtttattgaggttggtgggtatgtgttcttaacatactacgtcattgggtttgactcaaacgtgggcagcttcttcaagcagtatttgctcatgttagcaatcaatcagatggcgggatcacttttccgattcattggtggggcagcgaggaacatgattgttgcaaatgtctttgcatcattcatgctgctaatttttatggtattgggtggattcattctagcaagagagcaagtgaagaaatggtggatttggggctactggatatccccgatgatgtacgcccagaatgccatctcagttaatgaactcatggggcacagctggaacaaaattgtgaatagctctgcctccaatgagacccttggtgtgcaagtcctcaagtcccgtggagtattccctgaagccaggtggtattggattgggtttggtgcaatgatcggcttcaccatccttttcaatgctctcttcacccttgcccttacatacctcaggccatatggaaattcccgtcagtcagtatcagaagaggaactgaaagagaagcgtgccaatctgaatggtgagattgtgggtgacgttcacttgtcatctggaagtacgcgtaggccaatgggaaacggcactgaaaatgattcaacaattgttgatgatgatactgaggttactcaaagggggatggttctcccatttactccgctttcactcagctttgacaatgtcagatattctgttgacatgccacaggaaatgaaagcacaaggtgtagctgatgaccggttggagctcctcaaaggtgttagtggttcattcaggccaggggtgttgactgcactaatgggtgtcagtggtgctggcaagacaacactgatggatgtattggctgggagaaagacaggtgggtacattgaaggaagcatcaacatttcaggatatccaaagaaacaagagacttttgcacgtgtgtctggatactgtgagcagaacgatatccactcaccgcaggtcacagtctatgagtcgctacttttctcagcatggctccgtcttcctgaggatgtagattccaacactagaaagatgttcattgaggaggtgatggagcttgtggagctcaagtcactgagagatgctttggttgggcttcctggagtgaatggtctgtccactgaacaaagaaagaggctaacaatcgcagtggagcttgttgcaaacccttcgattatattcatggacgagccaacctcagggcttgatgcacgagcagctgcaattgtgatgaggacagtgaggaacactgttaatactggcagaactgtggtgtgcacaattcatcagcctagcattgacatatttgaagcatttgatgagcttttcctgatgaagcgaggtggtgaagagatctatgctggtccactaggccatcattcttcggagctgatcaagtattttgagagtatcccaggggtcagcaaaatcaaagatggctataacccagcaacatggatgttggaggtgacaacaattggtcaagagcaggcacttggtgttgattttagtgatatatacaagaagtctgaactttaccagaggaacaaggccttgataaaggacctgagccaaccagcccccgattcaagtgacctgtatttccctacccaatattctcagtcttctttaacacaatgcatggcttgcctgtggaagcaaaacctgtcatactggaggaaccctccttacaatgccgttaggttctttttcactactgtcattgctcttctctttggtaccatcttctgggaccttggcggcaaagtgacgaagtcacaagacttgttcaatgccatggggtcaatgtatgcagcagtgctgttcatcggtgtcatgaactgtacatctgttcagccagtggtggccgtggagcggacagtcttttaccgtgaaagggctgccggcatgtactcggcgtttccatatgcatttggccaggttgtcattgagatcccatacacactggttcaggctactgtatacgggatcatagtgtatgcgatgattgggttcgagtggacggctgccaagttcttctggtacctcttcttcatggtcttcacgctcctctacttcacattctacggcatgatggcggtcggcctgacaccgaactaccacattgcctcgatcgtctcatcggcgttctacgccatctggaatctcttctccggcttcgtcatcccccgacctagagtcccaatctggtggagatggtattgctgggcgtgccccgtcgcgtggacgctgtacggcctcgtcgtctcccagttcggtgacatcgagacgccgatggaagacggcacccctgtgaaggtgtttgtggagaactacttcggcttcaagcacagctggttgggctgggtggccaccgtggtcgctgccttcgctttcctcttcgcttccttgtttggcttcgctatcatgaagttcaacttccagaagagatga</cdnaseq>

Protein Sequence

<aaseq>MDAAGEIQKVASMRLGGSMRGDSGSMWRRGDDVFSRSSREEDDE EALRWAALEKLPTYDRVRRAILPLGGDDGAGDGGGKGVVDVHGLGPRERRALLERLVR VADEDNEKFLLKLKDRVDRVGIDMPTIEVRFEHLEAEAEVRVGNSGLPTVLNSITNTL EEAGNALGILPNRKQTMPVLHDVSGIIKPRRMTLLLGPPGSGKTTLLLALAGRLGKDL KASGKVTYNGHGMEEFVPERTAAYISQHDLHIGEMTVRETLAFSARCQGVGSRFDMLT ELSRREKAANIKPDADIDAFMKAAAMGGQEANVNTDYILKILGLEICADTMVGDEMLR GISGGQRKRVTTGEMLVGPARALFMDEISTGLDSSTTFQIVNSLRQTVHILGGTAVIS LLQPAPETYNLFDDIILLSDGQIVYQGPREDVLEFFESMGFKCPDRKGVADFLQEVTS KKDQRQYWARHDKPYRFVTVKEFVSAFQSFHTGRAIANELAVPFDKSKSHPAALATTR YGAPGKELLKANIDREILLMKRNSFVYMFRTFQLMVVSLIAMTLFFRTKMKRDSVTSG GIYMGALFFGVLMIMFNGFSELALTVFKLPVFFKQRDLLFYPAWSYTIPSWILKIPIT FIEVGGYVFLTYYVIGFDSNVGSFFKQYLLMLAINQMAGSLFRFIGGAARNMIVANVF ASFMLLIFMVLGGFILAREQVKKWWIWGYWISPMMYAQNAISVNELMGHSWNKIVNSS ASNETLGVQVLKSRGVFPEARWYWIGFGAMIGFTILFNALFTLALTYLRPYGNSRQSV SEEELKEKRANLNGEIVGDVHLSSGSTRRPMGNGTENDSTIVDDDTEVTQRGMVLPFT PLSLSFDNVRYSVDMPQEMKAQGVADDRLELLKGVSGSFRPGVLTALMGVSGAGKTTL MDVLAGRKTGGYIEGSINISGYPKKQETFARVSGYCEQNDIHSPQVTVYESLLFSAWL RLPEDVDSNTRKMFIEEVMELVELKSLRDALVGLPGVNGLSTEQRKRLTIAVELVANP SIIFMDEPTSGLDARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIFEAFDELFLMKRG GEEIYAGPLGHHSSELIKYFESIPGVSKIKDGYNPATWMLEVTTIGQEQALGVDFSDI YKKSELYQRNKALIKDLSQPAPDSSDLYFPTQYSQSSLTQCMACLWKQNLSYWRNPPY NAVRFFFTTVIALLFGTIFWDLGGKVTKSQDLFNAMGSMYAAVLFIGVMNCTSVQPVV AVERTVFYRERAAGMYSAFPYAFGQVVIEIPYTLVQATVYGIIVYAMIGFEWTAAKFF WYLFFMVFTLLYFTFYGMMAVGLTPNYHIASIVSSAFYAIWNLFSGFVIPRPRVPIWW RWYCWACPVAWTLYGLVVSQFGDIETPMEDGTPVKVFVENYFGFKHSWLGWVATVVAA FAFLFASLFGFAIMKFNFQKR</aaseq>

Gene Sequence

<dnaseqindica>6337..6594#5990..6244#5737..5908#5432..5659#5199..5332#5029..5112#4596..4886#4186..4518#3851..4101#3497..3763#3250..3410#2823..3139#2450..2731#2063..2364#1880..1970#1738..1791#1544..1620#1258..1417#904..988#487..696#20..381#gttttggtggtggtgggagatggacgcggcgggggagatccagaaggtggcgagcatgcggctaggggggagcatgaggggggacagcgggtcgatgtggaggagaggggacgacgtgttctcgaggtcgtcgagggaggaggacgacgaggaggcgctgcggtgggcggcgctcgagaagctgcccacctacgaccgcgtgcgccgcgccatcctgccgctcggtggcgacgacggcgccggggacggaggagggaagggcgtcgtggacgtgcacgggctcggcccgcgcgagcgccgcgcgctcctcgagcgcctcgtgcgcgtcgccgacgaggacaacgagaagttcctcctcaagctcaaggaccgcgtcgaccggtgcgtgcgttgccgccagttctcgtcttcgcatggccgcgtttctctgctttgcgcccgctaggtgtttgatctaacgactttcgcgcttgcgctgtgcgacagggtggggatcgacatgccgacgatcgaggtgcggttcgagcacctggaggcggaggcggaggtccgcgtcggcaacagcggcctccccaccgtcctcaactccatcaccaacaccctcgaggaagccggcaacgcgctcggcattctgcccaaccggaagcagaccatgcccgtcctccacgacgtcagcggcatcatcaagccccgcaggtgaaacaccatcccccccccccccccaacacactcccacacccacatgttgttttcaccaaaaaaaaaaagaacatggattctcttgtcttctggagcaatttttatctctcgtgttggagactggattagttaaatccgggtctttttttttagaattcaatttcttcgccttcttcccacctcacgttcttttcgtttctacaggatgactctgctgttaggcccaccggggtcaggcaagaccaccttgctgctcgcgttggccggaaggctcggcaaagatctcaaggttcgttcatccaaaaccaacttcttgcaaataattcaattccagatgcctgtatcccactataggcgcagtgtttcagcttctcatctctactagtagtactgctccagtacgtactaatacgaagaatgagttagccaaagaagaaaacacagagtagtacggggagttctttatttgggaaaaagaaaataagagatggatactggagtacgaattatactgggcgttcacacgttgttgatgagtataacgagatgcaattgcaggcttcaggaaaagtgacctacaacgggcacggcatggaggaattcgtgccggagaggacggcggcttacatcagccagcacgacctccacatcggagagatgaccgtcagggagacacttgccttctcggcacgatgccagggtgttggcagtcgctttggtaaattctacacgattctcagcagtagtagttgccttttttactgcttgcggattatgcgggattgcatggttggacgggcatgctaaaccaagttttcctttttcctgttgttttttttttcagatatgttgactgagctgtcaaggcgagagaaggcagcgaacattaagcctgacgccgatatcgatgcattcatgaaggtaaaaggatttacgaatccgaaataaaatcaacaagattttggtgtcctcttacttttgttaatttttctttttgaaacgaggactaagcattggttttctggtcaacttgttcaggcggctgcaatgggaggacaggaggcaaacgtgaacactgactatatactgaaggtgcatccatctttgagctagtgattaaattttaggtagaattacccaagaatttcttgttcaatgcattggacgttacttgttgcagatattaggactagagatatgcgctgacacgatggttggggacgagatgctgaggggcatctcaggtgggcaaagaaagcgtgttacgactggtgaggattgaactccaacacaaattcagattgagactaacggctatgaatgaaccacggtgtgattattcctattttgatgcgttctgtaggtgagatgctggttgggccagccagggcgctcttcatggacgagatctcaactgggcttgacagctccactacattccagatagtgaattcgcttaggcaaactgtccacatcctcggtggcacagctgttatctccctgctgcagccggcgcctgagacttacaacttgtttgatgatatcatcctcctctcagacggtcagattgtgtaccagggcccccgagaggatgtgcttgaattcttcgagtccatggggtttaagtgtcctgacaggaagggtgttgccgacttcttgcaagaagtatgttcatatctcactgttcttttttctatgaacacataaagtacagtttttgataatatatgtctgtgcaaatgccgagcaggtgacttctaagaaagatcaaaggcagtactgggcgaggcatgacaagccctacaggtttgtgacggttaaggaatttgtgagtgcattccagtcgttccacacagggagagctatagcaaacgaacttgctgttccgtttgataagagtaagagccatcctgccgcactggctaccacaaggtacggtgctcctggcaaggagctgctgaaggcaaatattgacagggagattctcctcatgaagaggaactctttcgtctacatgttcagaaccttccaggtaactgtcattacttcaaaccaaaggggtggttgctatgtaagtaaagcaatagcagcatgactgactccatggtgttatgtcattacagttgatggtggtgtcactcattgcaatgacactcttcttccgtacgaaaatgaaacgtgattctgtgaccagcgggggcatctacatgggcgcactcttctttggtgtgcttatgatcatgttcaatggtttctcagagcttgcgctcactgtctttaagttgcctgttttcttcaagcagagggatctccttttttatcctgcatggtcgtacactataccctcatggattctcaagatcccaatcacgtttattgaggttggtgggtatgtgttcttaacatactacgtcattgggtttgactcaaacgtgggcaggtgagatttattgagattatatatttcacaggtgtataatcagctatatcttactatagtgctgctctgcattgttctgagagtatttgtcttttttttgtttaccccagcttcttcaagcagtatttgctcatgttagcaatcaatcagatggcgggatcacttttccgattcattggtggggcagcgaggaacatgattgttgcaaatgtctttgcatcattcatgctgctaatttttatggtattgggtggattcattctagcaagaggtaaatgctcaccattatctgtctgagaagtgcttggtttgcactttttatcaaaagctaagtgttccattctgttcgacttgcagagcaagtgaagaaatggtggatttggggctactggatatccccgatgatgtacgcccagaatgccatctcagttaatgaactcatggggcacagctggaacaaaattgtgaatagctctgcctccaatgagacccttggtgtgcaagtcctcaagtcccgtggagtattccctgaagccaggtggtattggattgggtttggtgcaatgatcggcttcaccatccttttcaatgctctcttcacccttgcccttacatacctcaggcgtgagtataccttgagaactgatttgctctttttcctagagttggctatatccaaacatgagaatgatttcatcttgtgatttacagcatatggaaattcccgtcagtcagtatcagaagaggaactgaaagagaagcgtgccaatctgaatggtgagattgtgggtgacgttcacttgtcatctggaagtacgcgtaggccaatgggaaacggcactgaaaatgattcaacaattgttgatgatgatactgaggttactcaaagggggatggttctcccatttactccgctttcactcagctttgacaatgtcagatattctgttgacatgccacaggtaaaatatggaagaactcctaccaaatcaggaattgatcattagtttgcatttttctaactttcagcgtgaaattaatttcaggaaatgaaagcacaaggtgtagctgatgaccggttggagctcctcaaaggtgttagtggttcattcaggccaggggtgttgactgcactaatgggtgtcagtggtgctggcaagacaacactgatggatgtattggctgggagaaagacaggtgggtacattgaaggaagcatcaacatttcaggatatccaaagaaacaagagacttttgcacgtgtgtctggatactgtgagcagaacgatatccactcaccgcaggtcacagtctatgagtcgctacttttctcagcatggctccgtcttcctgaggatgtagattccaacactagaaaggtccgtcaaacatttttttttgctattcctacctatacttgatatagatagatagtagcttacctttgtgtatgcagatgttcattgaggaggtgatggagcttgtggagctcaagtcactgagagatgctttggttgggcttcctggagtgaatggtctgtccactgaacaaagaaagaggctaacaatcgcagtggagcttgttgcaaacccttcgattatattcatggacgagccaacctcagggcttgatgcacgagcagctgcaattgtgatgaggacagtgaggaacactgttaatactggcagaactgtggtgtgcacaattcatcagcctagcattgacatatttgaagcatttgatgaggtgagtgtgattctactttggagattcgtaccattttctcctcagatattaggatacattgcggaaagcccaaaaatcaattgattatggctgtgtttctaaactacctggatgatttgactaatatattttttgcttgcagcttttcctgatgaagcgaggtggtgaagagatctatgctggtccactaggccatcattcttcggagctgatcaagtattttgaggtaagtgatattacactaattctaatatacctcaatgacatttcttcaaaattactgattcaatcgcatctttgtgtatcatccagagtatcccaggggtcagcaaaatcaaagatggctataacccagcaacatggatgttggaggtgacaacaattggtcaagagcaggcacttggtgttgattttagtgatatatacaagaagtctgaactttaccagtgagtaacttgcttttaatcctaattgttgtttcatctttctgcaaagcaatttttttttgcaatatgccatgtaacactgattgctaccttattcaggaggaacaaggccttgataaaggacctgagccaaccagcccccgattcaagtgacctgtatttccctacccaatattctcagtcttctttaacacaatgcatggcttgcctgtggaagcaaaacctgtcatactggaggaaccctccttacaatgccgttaggttctttttcactactgtcattgctcttctctttggtaccatcttctgggaccttggcggcaaagtgtaagtaaaatgccactttctatatgcaaagagggtgtaccttagaaatcttattcatttcgtgcttcttaatccaggacgaagtcacaagacttgttcaatgccatggggtcaatgtatgcagcagtgctgttcatcggtgtcatgaactgtacatctgttcagccagtggtggccgtggagcggacagtcttttaccgtgaaagggctgccggcatgtactcggcgtttccatatgcatttggccaggtgaatggtcctcctgcaactgacattgagtcctggttgttgcatccttgagatccagatactgattaattcctctttcaggttgtcattgagatcccatacacactggttcaggctactgtatacgggatcatagtgtatgcgatgattgggttcgagtggacggctgccaagttcttctggtacctcttcttcatggtcttcacgctcctctacttcacattctacggcatgatggcggtcggcctgacaccgaactaccacattgcctcgatcgtctcatcggcgttctacgccatctggaatctcttctccggcttcgtcatcccccgacctgtaagtttcgcattcccaattgcccctcattcttccatacacttccaactccattgggtgctcatctctgtttgtgcctgatgatgtttcagagagtcccaatctggtggagatggtattgctgggcgtgccccgtcgcgtggacgctgtacggcctcgtcgtctcccagttcggtgacatcgagacgccgatggaagacggcacccctgtgaaggtgtttgtggagaactacttcggcttcaagcacagctggttgggctgggtggccaccgtggtcgctgccttcgctttcctcttcgcttccttgtttggcttcgctatcatgaagttcaacttccagaagagatgatgatgacaagggatattacattcattgagttgcaaacgctacctgaaatttgtgcatatcattggatctaaagaatttttttttgttgccattagaatattgtaaatcataccagcctttcccccttatttttatagaaagattgtactactgttacacctagtaattttgttattagtacccttctttttatagaaagatggtactacttttatttttaatttttatatggggttgtctagtgttcagttgactgaa</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0609300, RefSeq:Os01g0609300

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. 2.0 2.1 2.2 2.3 2.4 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  5. Cite error: Invalid <ref> tag; no text was provided for refs named ref5