Difference between revisions of "Os01g0771200"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
  XB24 promotes autophosphorylation of XA21 through its ATPase activity. Rice lines silenced for Xb24 display enhanced XA21-mediated immunity, whereas rice
+
*XB24 promotes autophosphorylation of XA21 through its ATPase activity. Rice lines silenced for Xb24 display enhanced XA21-mediated immunity, whereas rice
 
  lines overexpressing XB24 are compromised for immunity. XB24 ATPase enzyme activity is required for XB24 function. XA21 is degraded in the presence of the
 
  lines overexpressing XB24 are compromised for immunity. XB24 ATPase enzyme activity is required for XB24 function. XA21 is degraded in the presence of the
 
  pathogen-associated molecular pattern Ax21 when XB24 is overexpressed.  
 
  pathogen-associated molecular pattern Ax21 when XB24 is overexpressed.  
  To be more specifically, ⑴XB24 Physically Associates with XA21 in Vivo.⑵XB24 Dissociates from XA21 in Response to PXO99 Inoculation.⑶XB24 Possesses  
+
*To be more specifically, ⑴XB24 Physically Associates with XA21 in Vivo.⑵XB24 Dissociates from XA21 in Response to PXO99 Inoculation.⑶XB24 Possesses  
 
  ATPase Activity.⑷XB24 ATPase Enhances Autophosphorylation of XA21K668.⑸Silencing of Xb24 Enhances Xa21-Mediated Resistance. ⑹Overexpression of XB24  
 
  ATPase Activity.⑷XB24 ATPase Enhances Autophosphorylation of XA21K668.⑸Silencing of Xb24 Enhances Xa21-Mediated Resistance. ⑹Overexpression of XB24  
 
  Compromises XA21-Mediated Resistance.⑺ATPase Activity Is Essential for XB24-Mediated Regulation of XA21 Function.⑻Overexpression of Xb24 Causes XA21  
 
  Compromises XA21-Mediated Resistance.⑺ATPase Activity Is Essential for XB24-Mediated Regulation of XA21 Function.⑻Overexpression of Xb24 Causes XA21  

Revision as of 08:43, 5 June 2014

XB24 is a unique ATPase from a previously unclassified subclass.

Annotated Information

Function

*XB24 promotes autophosphorylation of XA21 through its ATPase activity. Rice lines silenced for Xb24 display enhanced XA21-mediated immunity, whereas rice
lines overexpressing XB24 are compromised for immunity. XB24 ATPase enzyme activity is required for XB24 function. XA21 is degraded in the presence of the
pathogen-associated molecular pattern Ax21 when XB24 is overexpressed. 
*To be more specifically, ⑴XB24 Physically Associates with XA21 in Vivo.⑵XB24 Dissociates from XA21 in Response to PXO99 Inoculation.⑶XB24 Possesses 
ATPase Activity.⑷XB24 ATPase Enhances Autophosphorylation of XA21K668.⑸Silencing of Xb24 Enhances Xa21-Mediated Resistance. ⑹Overexpression of XB24 
Compromises XA21-Mediated Resistance.⑺ATPase Activity Is Essential for XB24-Mediated Regulation of XA21 Function.⑻Overexpression of Xb24 Causes XA21 
Instability Following Ax21 Recognition.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0771200

Description

Similar to Mal d 1-associated protein

Version

NM_001050918.1 GI:115440206 GeneID:4324614

Length

1888 bp

Definition

Oryza sativa Japonica Group Os01g0771200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:34299150..34301037

Sequence Coding Region

34299283..34299494,34300420..34300804

Expression

GEO Profiles:Os01g0771200

Genome Context

<gbrowseImage1> name=NC_008394:34299150..34301037 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:34299150..34301037 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggttggcgttggcacgacgacggcgatgacggcggccgcggcctgggcgacatccccgacctcgccggcggcggcggaggcggagatggggagcgctgcgccacgcgccgggtggtgcagtctcggtgccacacggaggaggtggagcccggccgcttcgtccgcaagtgcgagaagaccgagcagctcctccgcgactgcgtcggcaggccctctgaactggtggaatcaaaaactgaaaatactgaagaagacgtcacagatgaaatgaaaagcgggtcactatctcttggttttccgaccaatgagccctttgcatttcctggacttcgcagtgacatagaagctcttgagaaaggccttttcgggagcattggtagctttctggatgatgctgagaggatgaccaatgatttcttgaagtcttttggtgtcccttccatcaatgaaagggagtcgagctcatttgatggacaacctacaggcaggcacattggtggacaacctgcaggcaggcacattgaggaaggtactgcaaaggacactaaacagaacgactacgcagaattcagcagcaagattacagatgtgtaa</cdnaseq>

Protein Sequence

<aaseq>MGWRWHDDGDDGGRGLGDIPDLAGGGGGGDGERCATRRVVQSRC HTEEVEPGRFVRKCEKTEQLLRDCVGRPSELVESKTENTEEDVTDEMKSGSLSLGFPT NEPFAFPGLRSDIEALEKGLFGSIGSFLDDAERMTNDFLKSFGVPSINERESSSFDGQ PTGRHIGGQPAGRHIEEGTAKDTKQNDYAEFSSKITDV</aaseq>

Gene Sequence

<dnaseqindica>134..345#1271..1655#agaaacgagccggccggattgctctccaagccaaacacggcccagagaggcgagagcccccacaccgccaaacccgacccggaaatcaactgcacacgctccgatcccctctctccagatcgattcggaccccatgggttggcgttggcacgacgacggcgatgacggcggccgcggcctgggcgacatccccgacctcgccggcggcggcggaggcggagatggggagcgctgcgccacgcgccgggtggtgcagtctcggtgccacacggaggaggtggagcccggccgcttcgtccgcaagtgcgagaagaccgagcagctcctccgcgactgcgtcggcaggtatatacatatactccatggcctcgcgcttttccctgatctgttccttcttttcctgcgaggatcccctctttgcatattactgttcgttgttttagtgatgaattggtgataacatgtcatgcgcagttgtgttactattagtcccgtgtatgattgtgagctgtgtatagccgcctctctgtggacgattttcgtgagtctgtcctcgctgatttgatacaaacacgaattcattaagaatggggaatgtgccgtgatgatcgagacgtttgagttctgtggtgaatagtatgatcaaatgtgtgtaataacttgggcttttgaattttggtagctaattagatatggaatttctatccagttttaggtgcccgtgccatcgacatgggttaaaagttattgtgggctattttgcgctcaacttgttaatcaacaaattttggacggaggcagtactttgtaggcatggggtaaatttgtatgatacacttgttgcttgaagatgttcgtgaactcatgggatttctagacacctacaaccaattacattacagtgttattatattctaacgatatgtaaagagcagctgtgttcgtgttgtctacactaaagattcaacaactagtggtcatcatcaaaccgatagcatatcctcattttgcaggattttgaaaactcacatctcgttagcatccttccttttatttcttcacatgcctcatgttaaacttttaagtgcatgaaacccaaatttctgtatttcgtagctccttgtaaccaatgtacaacactatgattagtattctggatagattttgtacttcccaaagtattttggttgttgacaagctattacaataatctgatggataacctaccatacattatttctcctaaccgatcacaataatcttcttctaggccctctgaactggtggaatcaaaaactgaaaatactgaagaagacgtcacagatgaaatgaaaagcgggtcactatctcttggttttccgaccaatgagccctttgcatttcctggacttcgcagtgacatagaagctcttgagaaaggccttttcgggagcattggtagctttctggatgatgctgagaggatgaccaatgatttcttgaagtcttttggtgtcccttccatcaatgaaagggagtcgagctcatttgatggacaacctacaggcaggcacattggtggacaacctgcaggcaggcacattgaggaaggtactgcaaaggacactaaacagaacgactacgcagaattcagcagcaagattacagatgtgtaaggatctacagttagctgacgcacctttgggagcagcttgccaattttgtattttgaacatctccatggttgtaattggaaggggaaggatcagtttgactgttttataagcagagtcgtctgaagtctgaagtgttgcgcttataagaacaattgtgtatattactgttttagataagcctgtttgtgttcctcaacaatgagatcaattatggatggtttttttctctgctt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0771200, RefSeq:Os01g0771200