Difference between revisions of "Os06g0499500"

From RiceWiki
Jump to: navigation, search
(Function)
(=Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function==
 
===Function==
The GH3 is a class of genes that respond to Auxin in some species of plants. The first GH3 gene was isolated from soybean by differential screening as an early auxin-responsive gene. The soybean GH3 transcription was shown to be specifically induced by biologically active auxins within5 min of exogenous auxin application. Also, unlike SAURs and Aux/IAAs, GH3 mRNAs do not accumulate in response to protein synthesis inhibitor cycloheximide
+
The GH3 is a class of genes that respond to Auxin in some species of plants. The GH3 proteins in Arabidopsis have been shown to be involved in plant growth and development, photomorphogenesis, light- and auxin-signaling, and auxin homeostasis. GH3 proteins from Arabidopsis and rice are divided into three and two groups, respectively. GH3 proteins classified in the same groups may have the similar functions in events common to both monocot and dicot plants. Group III GH3 proteins may have dicot-specific functions as they could not be identified from rice or other monocots. Organ-specific differential expression suggests diverse roles of these proteins during plant growth and development. The effect of light and auxin treatment on the transcript levels of OsGH3 genes implies their role in light and auxin signal transduction.
  
 
===Expression===
 
===Expression===

Revision as of 09:48, 5 June 2014

Please input one-sentence summary here.

Annotated Information

=Function

The GH3 is a class of genes that respond to Auxin in some species of plants. The GH3 proteins in Arabidopsis have been shown to be involved in plant growth and development, photomorphogenesis, light- and auxin-signaling, and auxin homeostasis. GH3 proteins from Arabidopsis and rice are divided into three and two groups, respectively. GH3 proteins classified in the same groups may have the similar functions in events common to both monocot and dicot plants. Group III GH3 proteins may have dicot-specific functions as they could not be identified from rice or other monocots. Organ-specific differential expression suggests diverse roles of these proteins during plant growth and development. The effect of light and auxin treatment on the transcript levels of OsGH3 genes implies their role in light and auxin signal transduction.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os06g0499500

Description

Similar to Indole-3-acetic acid-amido synthetase GH3.17 (EC 6.3.2.-) (Auxin- responsive GH3-like protein 17) (AtGH3-17)

Version

NM_001064239.1 GI:115468209 GeneID:4341111

Length

3752 bp

Definition

Oryza sativa Japonica Group Os06g0499500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:18463909..18467660

Sequence Coding Region

18464228..18464816,18466050..18466901,18467018..18467119,18467225..18467544

Expression

GEO Profiles:Os06g0499500

Genome Context

<gbrowseImage1> name=NC_008399:18463909..18467660 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:18463909..18467660 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgctcctgctgccggagttcgacccggcggacgtccgcgccggccgcgacctcatccaccgcctcaccgccgacgccgccggcatccagcggggcgtcctccgcgagatcctctcccggaactccggcaccgagtacctccgccgcttcctgggcggcgccgccggcgacgacgacgacgtgcgagacgcattcaagaggcgcgtccccgtgtccggctacgaggatgtcaagccgtacgtcgaccgcgtcgcgtccggcggcgagccctcctctgccctcctctgctccgaccccatcacctgcctcagcaggagctccggcacgtccggcgggcagcagaagctgttgccgtccaccgcggaggagctcgacaggaaggtattcttctatgctgtccaggcgctcgtgaggaacatgagcttgcacaccgatcatggtgaagacgacgacggcggtggtggcgagggaatgtacctcatgttcgccttccacggtgaccggacattgtctggcctgcccatccagtctgctctaactacctactaccacagcagacagtttcaggaatgcgacattggcgggtttgataagtgcacaagccccctggaggcaatcctctgcccctatggcgagcagagcatgtactgccagttgctctgtggcctacttcaccgatgcagagtggaccgtgttggtgccagctttgccgctgggttggttcgggggatcaagttcttggaaaatcactgggaggagatgtgcttcaacatccggagcgggcagctcagcgactggatcacgcatactcctctgcgtgatgcggtcactggacagtatcttcaaggatctaacccagctttagccgatgagattgcatccgagtgtgcgaggaaaccttgggatgggatagtcaggaggctatggcctagggcacggtatatccggaccattgtgactggttcaatgtcacagtacattccaattcttgaggtttatggtggcgggctaccgttggtctcaccaatctatgcatctacagaatgcgctgccgggataaatctgaggccacttgatccaccatcccatgtgtcatatgcattgcttccaaacattgcttactttgagttcttggaggtcatggatgaaaatggtgaaaaggtacaaggaactaccaggcttgatgacaatttgggtgaggtaaaagttgttgaccttgtggatgtcaaagttggtcgatgctatgagttgattgtcactacctttgcaggtctttacaggtaccgggtgggtgacctgtttactgtgagtggcttctacaatgcgacgccattgtttcacttctcaggacggcatgatgtcatcctaagcatagattacgagaagataagtgaggaggaccttctcaatgccattgcagaaacagataagttccacctcaggcctcttggctacatgcttgttggtagcactgcatatgcagacatatccactttgcctggccactatatccttttctgggagctgaccaatacctgtgatagcaatgttgccattgacatcgaccaaactgccatggagaagtgttgcttggcagtggaagaccacttcgatgaaatgtaccgcaaaattaggcaccgtggctcaatcagtgcgctcgagataaggattcttagccatggtgcgtttgatgctctgatggacttctttgtgtctagagggacatcagcgagtcaatacaaaactccgacagccattcggtcgaaagaggcgatgatggtattggaggaaagggttgtaggaaggtttttcagccaagcaactcccagctgtcgttcagccgaatttgagaggagataa</cdnaseq>

Protein Sequence

<aaseq>MALLLPEFDPADVRAGRDLIHRLTADAAGIQRGVLREILSRNSG TEYLRRFLGGAAGDDDDVRDAFKRRVPVSGYEDVKPYVDRVASGGEPSSALLCSDPIT CLSRSSGTSGGQQKLLPSTAEELDRKVFFYAVQALVRNMSLHTDHGEDDDGGGGEGMY LMFAFHGDRTLSGLPIQSALTTYYHSRQFQECDIGGFDKCTSPLEAILCPYGEQSMYC QLLCGLLHRCRVDRVGASFAAGLVRGIKFLENHWEEMCFNIRSGQLSDWITHTPLRDA VTGQYLQGSNPALADEIASECARKPWDGIVRRLWPRARYIRTIVTGSMSQYIPILEVY GGGLPLVSPIYASTECAAGINLRPLDPPSHVSYALLPNIAYFEFLEVMDENGEKVQGT TRLDDNLGEVKVVDLVDVKVGRCYELIVTTFAGLYRYRVGDLFTVSGFYNATPLFHFS GRHDVILSIDYEKISEEDLLNAIAETDKFHLRPLGYMLVGSTAYADISTLPGHYILFW ELTNTCDSNVAIDIDQTAMEKCCLAVEDHFDEMYRKIRHRGSISALEIRILSHGAFDA LMDFFVSRGTSASQYKTPTAIRSKEAMMVLEERVVGRFFSQATPSCRSAEFERR</aaseq>

Gene Sequence

<dnaseqindica>2845..3433#760..1611#542..643#117..436#agttccccttcttcctccctgtgcttttcccctttcctttctctgatttctctcaaatgaattactgttaccagttggtgtgattctccagccgaaacttcaccaaccaagcaggaatggcgctcctgctgccggagttcgacccggcggacgtccgcgccggccgcgacctcatccaccgcctcaccgccgacgccgccggcatccagcggggcgtcctccgcgagatcctctcccggaactccggcaccgagtacctccgccgcttcctgggcggcgccgccggcgacgacgacgacgtgcgagacgcattcaagaggcgcgtccccgtgtccggctacgaggatgtcaagccgtacgtcgaccgcgtcgcgtccggcggcgagccctcctctgccctcctctgctccgaccccatcacctgcctcagcaggaggtaaaatttccgcaaatcgggggcggcgttgctccgagttgggataaaccctagctctttgccctcactcacggtaccatctaatttcaatgcgaacggcggcagctccggcacgtccggcgggcagcagaagctgttgccgtccaccgcggaggagctcgacaggaaggtattcttctatgctgtccaggcgctcgtgaggaacatgtaagagcatgactggtgtggtgctttgctcatcattaatcaactggcatattcttgaatttctgtagcaattaacttgctcaattaatatactatattttttgcatttctactaggagcttgcacaccgatcatggtgaagacgacgacggcggtggtggcgagggaatgtacctcatgttcgccttccacggtgaccggacattgtctggcctgcccatccagtctgctctaactacctactaccacagcagacagtttcaggaatgcgacattggcgggtttgataagtgcacaagccccctggaggcaatcctctgcccctatggcgagcagagcatgtactgccagttgctctgtggcctacttcaccgatgcagagtggaccgtgttggtgccagctttgccgctgggttggttcgggggatcaagttcttggaaaatcactgggaggagatgtgcttcaacatccggagcgggcagctcagcgactggatcacgcatactcctctgcgtgatgcggtcactggacagtatcttcaaggatctaacccagctttagccgatgagattgcatccgagtgtgcgaggaaaccttgggatgggatagtcaggaggctatggcctagggcacggtatatccggaccattgtgactggttcaatgtcacagtacattccaattcttgaggtttatggtggcgggctaccgttggtctcaccaatctatgcatctacagaatgcgctgccgggataaatctgaggccacttgatccaccatcccatgtgtcatatgcattgcttccaaacattgcttactttgagttcttggaggtcatggatgaaaatggtgaaaaggtacaaggaactaccaggcttgatgacaatttgggtgaggtaaaagttgttgaccttgtggatgtcaaagttggtcgatgctatgagttgattgtcactacctttgcaggcaagctgttgggctactttttatcccttttttttcagacatggctaggtttatcttatatctgatcattgaaagctctcatcgatttcttgtagctatgcttgcaatcataatttgtgtttcatcgcatttttcaaaatcagttctctccaatgttaggtaaatttattgatatctggataagcatctttcaagacccatgacacctatttaagtcctcaattagcttgtgaatgagaagtccgaaattttatatcctgttatatcagctactatacgtttattatattcaggacacacatttagtggaacaatgcaaatttcgaataattacttcagatcccatggaaaaggcaaaacctaccatttttttacgaaatagcataatgtctgctattaacttcattaatggaggagcatacaaaaacaaggtttaaagttacaagaaaaagatagcacttgaaagttgaaaactcaatcataagtagaatggaccaagaaaaccttagagcaagattctccattaacagtagagcaccatatgagattgtttttttttttctttgttaattgtttccccctcaagttccattacttatatgtagtcctaatggtctattaattggattttgcttgtgtcatcctggctttgttttgcttgtatgatatcctatatttgtaagacaaattttgctacaggacactcaaagtttgtgtaatttgctggtggacatcgtaaaaacgtgccaccgttgaagaacaccctaaaaaactagtaatttgttagatgacatttccagtctaattggggagaaaactcttcaagaagacgagaatgcccatacggccacaagcttctaacctgttgttggagtgaaaatttggaaattatacaactctcaatatccaatcatcccaagtatattccaagcatatctcatatttcatcttcactctagcgctaggttacaggcttgtggctccaggggcattctcatcatttttctctccaattgggctagaaatgtccttgtggcaaattaccagttttttggagtgtcgtctagctgtgacacgtttttgtgatgtccaccagcaaattacacaaacctgtcctgtagcaaaattattgaacaagggtagattccaacattttagaaaaataggattctgaatcagcccaggtaaacaacatcctgtattttgactttgtgacttgtgcatttataataggtctttacaggtaccgggtgggtgacctgtttactgtgagtggcttctacaatgcgacgccattgtttcacttctcaggacggcatgatgtcatcctaagcatagattacgagaagataagtgaggaggaccttctcaatgccattgcagaaacagataagttccacctcaggcctcttggctacatgcttgttggtagcactgcatatgcagacatatccactttgcctggccactatatccttttctgggagctgaccaatacctgtgatagcaatgttgccattgacatcgaccaaactgccatggagaagtgttgcttggcagtggaagaccacttcgatgaaatgtaccgcaaaattaggcaccgtggctcaatcagtgcgctcgagataaggattcttagccatggtgcgtttgatgctctgatggacttctttgtgtctagagggacatcagcgagtcaatacaaaactccgacagccattcggtcgaaagaggcgatgatggtattggaggaaagggttgtaggaaggtttttcagccaagcaactcccagctgtcgttcagccgaatttgagaggagataataattgtactgcctgttcggttggcgtctcggtgacaggagagggcatgttccttatgaaaagttcagtcctgatcacgaataagtggcgcagcattgcaattcgtgcactggagaaggatgatccactcatctccatcttggcacgtcctttttcagtctggaatttggtctcaggagtatcatttcgtgttttcttgtaaattcagaaagaacttctgtactgctccttccacatagcctttgggcgtaactgtagacacaacccttgctccgaggtttataagttacctccgaatttactgattgactgtgttctc</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0499500, RefSeq:Os06g0499500