Difference between revisions of "Os03g0285800"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Annotated Information)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
1.1 Function
+
===Function===
 
Mitogen-activated protein kinase (MAPK) cascades play an important role in mediating stress responses in eukaryotic organisms.However, little is known about the role of MAPKs in modulating the interaction of defense pathways activated by biotic and abiotic factors. In this study, we have isolated and functionally characterized a stress-responsive MAPK gene (OsMAPK5) from rice.OsMAPK5 is a single-copy gene but can generate at least two differentially spliced transcripts. TheOsMAPK5 gene, its protein, and kinase activity were inducible by abscisic acid as well as various biotic (pathogen infection)and abiotic (wounding, drought, salt, and cold) stresses. To determine its biological function, we generated and analyzedtransgenic rice plants with overexpression (using the 35S promoter of Cauliflower mosaic virus) or suppression (using double-stranded RNA interference [dsRNAi]) ofOsMAPK5. Interestingly, suppression of OsMAPK5 expression and its kinase activity resulted in the constitutive expression of pathogenesis-related (PR) genes such as PR1 and PR10 in the dsRNAitransgenic plants and significantly enhanced resistance to fungal ( Magnaporthe grisea) and bacterial (Burkholderia glumae)pathogens. However, these same dsRNAi lines had significant reductions in drought, salt, and cold tolerance. By contrast, overexpression lines exhibited increased OsMAPK5 kinase activity and increased tolerance to drought, salt, and cold stresses. These results strongly suggest that OsMAPK5 can positively regulate drought, salt, and cold tolerance and negatively Modulate PR gene expression and broad-spectrum disease resistance.
 
Mitogen-activated protein kinase (MAPK) cascades play an important role in mediating stress responses in eukaryotic organisms.However, little is known about the role of MAPKs in modulating the interaction of defense pathways activated by biotic and abiotic factors. In this study, we have isolated and functionally characterized a stress-responsive MAPK gene (OsMAPK5) from rice.OsMAPK5 is a single-copy gene but can generate at least two differentially spliced transcripts. TheOsMAPK5 gene, its protein, and kinase activity were inducible by abscisic acid as well as various biotic (pathogen infection)and abiotic (wounding, drought, salt, and cold) stresses. To determine its biological function, we generated and analyzedtransgenic rice plants with overexpression (using the 35S promoter of Cauliflower mosaic virus) or suppression (using double-stranded RNA interference [dsRNAi]) ofOsMAPK5. Interestingly, suppression of OsMAPK5 expression and its kinase activity resulted in the constitutive expression of pathogenesis-related (PR) genes such as PR1 and PR10 in the dsRNAitransgenic plants and significantly enhanced resistance to fungal ( Magnaporthe grisea) and bacterial (Burkholderia glumae)pathogens. However, these same dsRNAi lines had significant reductions in drought, salt, and cold tolerance. By contrast, overexpression lines exhibited increased OsMAPK5 kinase activity and increased tolerance to drought, salt, and cold stresses. These results strongly suggest that OsMAPK5 can positively regulate drought, salt, and cold tolerance and negatively Modulate PR gene expression and broad-spectrum disease resistance.
  
Line 9: Line 9:
 
RAI1 encodes a putative basic helix–loop–helix transcription factor. A microarray analysis of cells transformed with an inducible RAI1 construct showed increased expression of PAL1 and OsWRKY19 genes after induction, suggesting that these genes are regulated by RAI1. This was confirmed using RAI1 T-DNA activation-tagged and RNA interference lines. The PAL1 and OsWRKY19 genes were also up-regulated by sphingolipid and chitin elicitors, and the RAI1 activationtagged plants had increased resistance to a rice blast fungus. These results indicated that RAI1 is involved in defense responses in rice. RAI1 interacted with OsMAPK3 and OsMAPK6 proteins in vivo and in vitro. Also, RAI1 was phosphorylated by OsMAPK3/6 and OsMKK4-dd in vitro. Overexpression of OsMAPK6 and/or OsMAPK3 together with OsMKK4-dd increased PAL1 and OsWRKY19 expression in rice protoplasts. Therefore, the regulation of PAL1 and OsWRKY19 expression by RAI1 could be controlled via an OsMKK4–OsMAPK3/6 cascade. Co-immunoprecipitation assays indicated that OsMAPK3 and OsRac1 occur in the same complex as OsMAPK6
 
RAI1 encodes a putative basic helix–loop–helix transcription factor. A microarray analysis of cells transformed with an inducible RAI1 construct showed increased expression of PAL1 and OsWRKY19 genes after induction, suggesting that these genes are regulated by RAI1. This was confirmed using RAI1 T-DNA activation-tagged and RNA interference lines. The PAL1 and OsWRKY19 genes were also up-regulated by sphingolipid and chitin elicitors, and the RAI1 activationtagged plants had increased resistance to a rice blast fungus. These results indicated that RAI1 is involved in defense responses in rice. RAI1 interacted with OsMAPK3 and OsMAPK6 proteins in vivo and in vitro. Also, RAI1 was phosphorylated by OsMAPK3/6 and OsMKK4-dd in vitro. Overexpression of OsMAPK6 and/or OsMAPK3 together with OsMKK4-dd increased PAL1 and OsWRKY19 expression in rice protoplasts. Therefore, the regulation of PAL1 and OsWRKY19 expression by RAI1 could be controlled via an OsMKK4–OsMAPK3/6 cascade. Co-immunoprecipitation assays indicated that OsMAPK3 and OsRac1 occur in the same complex as OsMAPK6
  
1.2 Expression
+
===Expression===
 +
Please input expression information here.
 
Rice (Oryza sativa) anther development is easily damaged by moderately low temperatures above 12°C. Subtractivescreening of cDNA that accumulated in 12°C-treated anthers identified a cDNA clone, OsMEK1, encoding a protein withfeatures characteristic of a mitogen-activated protein (MAP) kinase kinase. The putative OsMEK1 protein shows 92%identity to the maize (Zea mays) MEK homolog, ZmMEK1. OsMEK1 transcript levels were induced in rice anthers by 12°Ctreatment for 48 h. Similar OsMEK1 induction was observed in shoots and roots of seedlings that were treated at 12°C forup to 24 h. It is interesting that no induction of OsMEK1 transcripts was observed in 4°C-treated seedlings. In contrast, ricelip19, encoding a bZIP protein possibly involved in low temperature signal transduction, was not induced by 12°C treatmentbut was induced by 4°C treatment. Among the three MAP kinase homologs cloned, only OsMAP1 displayed similar12°C-specific induction pattern as OsMEK1. A yeast two-hybrid system revealed that OsMEK1 interacts with OsMAP1, butnot with OsMAP2 and OsMAP3, suggesting that OsMEK1 and OsMAP1 probably function in the same signaling pathway.An in-gel assay of protein kinase activity revealed that a protein kinase (approximately 43 kD), which preferentially uses myelin basic protein as a substrate, was activated by 12°C treatment but not by 4°C treatment. Taken together, these resultslead us to conclude that at least two signaling pathways for low temperature stress exist in rice, and that a MAP kinasepathway with OsMEK1 and OsMAP1 components is possibly involved in the signaling for the higher range low-temperature stress.
 
Rice (Oryza sativa) anther development is easily damaged by moderately low temperatures above 12°C. Subtractivescreening of cDNA that accumulated in 12°C-treated anthers identified a cDNA clone, OsMEK1, encoding a protein withfeatures characteristic of a mitogen-activated protein (MAP) kinase kinase. The putative OsMEK1 protein shows 92%identity to the maize (Zea mays) MEK homolog, ZmMEK1. OsMEK1 transcript levels were induced in rice anthers by 12°Ctreatment for 48 h. Similar OsMEK1 induction was observed in shoots and roots of seedlings that were treated at 12°C forup to 24 h. It is interesting that no induction of OsMEK1 transcripts was observed in 4°C-treated seedlings. In contrast, ricelip19, encoding a bZIP protein possibly involved in low temperature signal transduction, was not induced by 12°C treatmentbut was induced by 4°C treatment. Among the three MAP kinase homologs cloned, only OsMAP1 displayed similar12°C-specific induction pattern as OsMEK1. A yeast two-hybrid system revealed that OsMEK1 interacts with OsMAP1, butnot with OsMAP2 and OsMAP3, suggesting that OsMEK1 and OsMAP1 probably function in the same signaling pathway.An in-gel assay of protein kinase activity revealed that a protein kinase (approximately 43 kD), which preferentially uses myelin basic protein as a substrate, was activated by 12°C treatment but not by 4°C treatment. Taken together, these resultslead us to conclude that at least two signaling pathways for low temperature stress exist in rice, and that a MAP kinasepathway with OsMEK1 and OsMAP1 components is possibly involved in the signaling for the higher range low-temperature stress.
 
Evolution===
 
Evolution===

Revision as of 11:50, 5 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Mitogen-activated protein kinase (MAPK) cascades play an important role in mediating stress responses in eukaryotic organisms.However, little is known about the role of MAPKs in modulating the interaction of defense pathways activated by biotic and abiotic factors. In this study, we have isolated and functionally characterized a stress-responsive MAPK gene (OsMAPK5) from rice.OsMAPK5 is a single-copy gene but can generate at least two differentially spliced transcripts. TheOsMAPK5 gene, its protein, and kinase activity were inducible by abscisic acid as well as various biotic (pathogen infection)and abiotic (wounding, drought, salt, and cold) stresses. To determine its biological function, we generated and analyzedtransgenic rice plants with overexpression (using the 35S promoter of Cauliflower mosaic virus) or suppression (using double-stranded RNA interference [dsRNAi]) ofOsMAPK5. Interestingly, suppression of OsMAPK5 expression and its kinase activity resulted in the constitutive expression of pathogenesis-related (PR) genes such as PR1 and PR10 in the dsRNAitransgenic plants and significantly enhanced resistance to fungal ( Magnaporthe grisea) and bacterial (Burkholderia glumae)pathogens. However, these same dsRNAi lines had significant reductions in drought, salt, and cold tolerance. By contrast, overexpression lines exhibited increased OsMAPK5 kinase activity and increased tolerance to drought, salt, and cold stresses. These results strongly suggest that OsMAPK5 can positively regulate drought, salt, and cold tolerance and negatively Modulate PR gene expression and broad-spectrum disease resistance.

Bphi008a up-regulation and down-regulation were accompanied by different changes in transcription levels of OsMPK5, OsMPK12, OsMPK13, and OsMPK17 in transgenic plants. Immunoblot analysis also showed that the OsMPK5 protein level increased in overexpressing plants and decreased in RNA interference plants after BPH feeding. In transgenic lines, changes in the expression levels of several enzymes that are important components of the defenses against the BPH were also observed. Finally, yeast two-hybrid screening results showed that Bphi008a is able to interact with a b-ZIP transcription factor (OsbZIP60) and a RNA polymerase polypeptide (SDRP).

RAI1 encodes a putative basic helix–loop–helix transcription factor. A microarray analysis of cells transformed with an inducible RAI1 construct showed increased expression of PAL1 and OsWRKY19 genes after induction, suggesting that these genes are regulated by RAI1. This was confirmed using RAI1 T-DNA activation-tagged and RNA interference lines. The PAL1 and OsWRKY19 genes were also up-regulated by sphingolipid and chitin elicitors, and the RAI1 activationtagged plants had increased resistance to a rice blast fungus. These results indicated that RAI1 is involved in defense responses in rice. RAI1 interacted with OsMAPK3 and OsMAPK6 proteins in vivo and in vitro. Also, RAI1 was phosphorylated by OsMAPK3/6 and OsMKK4-dd in vitro. Overexpression of OsMAPK6 and/or OsMAPK3 together with OsMKK4-dd increased PAL1 and OsWRKY19 expression in rice protoplasts. Therefore, the regulation of PAL1 and OsWRKY19 expression by RAI1 could be controlled via an OsMKK4–OsMAPK3/6 cascade. Co-immunoprecipitation assays indicated that OsMAPK3 and OsRac1 occur in the same complex as OsMAPK6

Expression

Please input expression information here. Rice (Oryza sativa) anther development is easily damaged by moderately low temperatures above 12°C. Subtractivescreening of cDNA that accumulated in 12°C-treated anthers identified a cDNA clone, OsMEK1, encoding a protein withfeatures characteristic of a mitogen-activated protein (MAP) kinase kinase. The putative OsMEK1 protein shows 92%identity to the maize (Zea mays) MEK homolog, ZmMEK1. OsMEK1 transcript levels were induced in rice anthers by 12°Ctreatment for 48 h. Similar OsMEK1 induction was observed in shoots and roots of seedlings that were treated at 12°C forup to 24 h. It is interesting that no induction of OsMEK1 transcripts was observed in 4°C-treated seedlings. In contrast, ricelip19, encoding a bZIP protein possibly involved in low temperature signal transduction, was not induced by 12°C treatmentbut was induced by 4°C treatment. Among the three MAP kinase homologs cloned, only OsMAP1 displayed similar12°C-specific induction pattern as OsMEK1. A yeast two-hybrid system revealed that OsMEK1 interacts with OsMAP1, butnot with OsMAP2 and OsMAP3, suggesting that OsMEK1 and OsMAP1 probably function in the same signaling pathway.An in-gel assay of protein kinase activity revealed that a protein kinase (approximately 43 kD), which preferentially uses myelin basic protein as a substrate, was activated by 12°C treatment but not by 4°C treatment. Taken together, these resultslead us to conclude that at least two signaling pathways for low temperature stress exist in rice, and that a MAP kinasepathway with OsMEK1 and OsMAP1 components is possibly involved in the signaling for the higher range low-temperature stress. Evolution=== Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here. 1. Sung-Hyun Kim;Tetsuo Oikawa;Junko Kyozuka;Hann Ling Wong;Kenji Umemura;Mitsuko Kishi-Kaboshi;Akira Takahashi;Yoji Kawano;Tsutomu Kawasaki;Ko Shimamoto

 The bHLH Rac Immunity1 (RAI1) Is Activated by OsRac1 via OsMAPK3 and OsMAPK6 in Rice Immunity
 Plant and Cell Physiology, 2012, 53(4): 740-754

2. Jiang-Qi Wen;Kiyoharu Oono;Ryozo Imai

 Two Novel Mitogen-Activated Protein Signaling Components, OsMEK1 and OsMAP1, Are Involved in a Moderate Low-Temperature Signaling Pathway in Rice
 Plant Physiology, 2002, 129(4): 1880-1891

3. Lizhong Xiong;Yinong Yang

 Disease Resistance and Abiotic Stress Tolerance in Rice Are Inversely Modulated by an Abscisic Acid–Inducible Mitogen-Activated Protein Kinase
 The Plant Cell, 2003, 15(3): 745-759

4. Jing Hu;Jiangbo Zhou;Xinxin Peng;Henghao Xu;Caixiang Liu;Bo Du;Hongyu Yuan;Lili Zhu;Guangcun He

 The Bphi008a Gene Interacts with the Ethylene Pathway and Transcriptionally Regulates MAPK Genes in the Response of Rice to Brown Planthopper Feeding
 Plant Physiology, 2011, 156(2): 856-872

Structured Information

Gene Name

Os03g0285800

Description

MAP Kinase

Version

NM_001056305.1 GI:115452338 GeneID:4332475

Length

2662 bp

Definition

Oryza sativa Japonica Group Os03g0285800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:9898386..9901047

Sequence Coding Region

9898577..9898749,9899280..9899463,9899548..9899880,9900012..9900149,9900264..9900393
,9900708..9900859

Expression

GEO Profiles:Os03g0285800

Genome Context

<gbrowseImage1> name=NC_008396:9898386..9901047 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:9898386..9901047 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggacggggcgccggtggcggagttcaggccgacgatgacgcacggcggccggtacctgctctacgacatcttcgggaacaagttcgaggtgacgaacaagtaccagccgcccatcatgcccattggccgcggcgcctacgggatcgtctgctccgtgatgaactttgagacgagggagatggtggcgataaagaagatcgccaacgcgttcaacaacgacatggacgccaagcgcacgctccgggagatcaagctcctcaggcacctcgaccacgagaacatcataggcatcagggatgtgatcccgccgccgatccctcaggcgttcaacgacgtctacatcgccacggagctcatggacaccgacctccatcacatcatccgctccaaccaagaactgtcagaagagcactgccagtatttcctgtaccagatcctgcgggggctcaagtacatccactcggcgaacgtgatccaccgcgacctgaagccgagcaacctgctgctgaacgccaactgcgacctcaagatctgcgacttcgggctggcgcggccgtcgtcggagagcgacatgatgacggagtacgtggtcacccggtggtaccgcgcgccggagctgctgctcaactccaccgactactccgccgccatcgacgtctggtccgtcggctgcatcttcatggagctcatcaaccgccagccgctcttccccggcagggaccacatgcaccagatgcgcctcatcaccgaggtgatcgggacgccgacggacgacgagctggggttcatacggaacgaggacgcgaggaagtacatgaggcacctgccgcagtacccgcgccggacgttcgcgagcatgttcccgcgggtgcagcccgccgcgctcgacctcatcgagaggatgctcaccttcaacccgctgcagagaatcacagttgaggaggcgctcgatcatccttacctagagagattgcacgacatcgccgatgagcccatctgcctggagcccttctccttcgacttcgagcagaaggctctaaacgaggaccaaatgaagcagctgatcttcaacgaagcgatcgagatgaacccaaacatccggtactag</cdnaseq>

Protein Sequence

<aaseq>MDGAPVAEFRPTMTHGGRYLLYDIFGNKFEVTNKYQPPIMPIGR GAYGIVCSVMNFETREMVAIKKIANAFNNDMDAKRTLREIKLLRHLDHENIIGIRDVI PPPIPQAFNDVYIATELMDTDLHHIIRSNQELSEEHCQYFLYQILRGLKYIHSANVIH RDLKPSNLLLNANCDLKICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAI DVWSVGCIFMELINRQPLFPGRDHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHL PQYPRRTFASMFPRVQPAALDLIERMLTFNPLQRITVEEALDHPYLERLHDIADEPIC LEPFSFDFEQKALNEDQMKQLIFNEAIEMNPNIRY</aaseq>

Gene Sequence

<dnaseqindica>2299..2471#1585..1768#1168..1500#899..1036#655..784#189..340#agcgatcacaaattgtgccaattcacaaaccgccgcccccttccctttttaatagctgccttcgcctctcgtcccctctccctcatcgccttgctgtctctgcgaatcgagagagagtcagataaggtcgttaattaggtttgtcaattcggctgcttgcggcgagagaagaggaggagggattagggatggacggggcgccggtggcggagttcaggccgacgatgacgcacggcggccggtacctgctctacgacatcttcgggaacaagttcgaggtgacgaacaagtaccagccgcccatcatgcccattggccgcggcgcctacgggatcgtctggtacgcacacgccgattcctcttttccctgcctgccctagatttcttgccatgttaatcgatccttcgtcagttccttttgattgattgatacgcgtcgatgagtggttgagaggatggagtaattgggaccaattactaatcccctgtttttagagcagggatgattaatttgattctgcagctgagctgagcaggtttttagttagttattatcagcgtagtggttgactggttggcatgtctattcggagtactttttggtgctttgtttttctaatttctcttctgaattccgtgtgctggtgcctacagctccgtgatgaactttgagacgagggagatggtggcgataaagaagatcgccaacgcgttcaacaacgacatggacgccaagcgcacgctccgggagatcaagctcctcaggcacctcgaccacgagaacgtaagctcctattaggctataactagtagtggaactgaagactacgtggttaattacgcagcggcgtgtacctgaatttggtaatctgtcactaactgctacaacaacacgcagatcataggcatcagggatgtgatcccgccgccgatccctcaggcgttcaacgacgtctacatcgccacggagctcatggacaccgacctccatcacatcatccgctccaaccaagaactgtcagaagagcactgccaggtgagtgaactgtgagcgaatgattttttttttcatatatcgatcaatcacacaatcaatcgatagctgcagaaacatcaattcgatcttcctcatgtcacgtatgtatgattgcggccgtgttgttgcagtatttcctgtaccagatcctgcgggggctcaagtacatccactcggcgaacgtgatccaccgcgacctgaagccgagcaacctgctgctgaacgccaactgcgacctcaagatctgcgacttcgggctggcgcggccgtcgtcggagagcgacatgatgacggagtacgtggtcacccggtggtaccgcgcgccggagctgctgctcaactccaccgactactccgccgccatcgacgtctggtccgtcggctgcatcttcatggagctcatcaaccgccagccgctcttccccggcagggaccacatgcaccagatgcgcctcatcaccgaggtgagtgaattaatcagcgtagacactcacacgctgaattatgctacctgttcttgggtctcatcgtgttgggtccatgatcaggtgatcgggacgccgacggacgacgagctggggttcatacggaacgaggacgcgaggaagtacatgaggcacctgccgcagtacccgcgccggacgttcgcgagcatgttcccgcgggtgcagcccgccgcgctcgacctcatcgagaggatgctcaccttcaacccgctgcagagaatcacaggtgcgtgcagagggctaacccaactcgtgcttgctgctctgcttctaaactactaaaattagtacccaaaattacaagtactaatttactagctgagtgtgtactgtgtacagtaccctgttcagtatgctactgcatgtgtgctagtatagcactagtattttctatcgcactgcttctttgactggcgtatatagccgccggtgtttgacccatccccaactatttttatgtttacttgccgtgaacagtcggtctcttgatctcgtcactttaaagggaacccgtcttttagctgtctttggggctaccaacgattttgcatgttgctcaagtgacgataaaagactgtgttactttactgtgtagtagtgcagaagtagaataggtagcacgtttgcagcctctgtcggttagagttcagtagaccttagttttgaaacactagacaatagcagagtggtttagaaggatgacagaagatttgtgcttaagaactatatctcactgacatcgttcttgacatgcagttgaggaggcgctcgatcatccttacctagagagattgcacgacatcgccgatgagcccatctgcctggagcccttctccttcgacttcgagcagaaggctctaaacgaggaccaaatgaagcagctgatcttcaacgaagcgatcgagatgaacccaaacatccggtactagattgaatcaccatggaaatgagatcccgtctatacctgctttgtacatatgatcaagattgagagccgggtagactgaacattgcatttgtttgtttgttgatgttcgaaacccacattctctgcaagttgtggctgctttgtatgatatatggtactatgttcgaataaaagggtttggaactttggatt</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0285800, RefSeq:Os03g0285800