Difference between revisions of "Os01g0293100"

From RiceWiki
Jump to: navigation, search
(Function)
(Expression)
Line 23: Line 23:
 
===Expression===
 
===Expression===
 
Please input expression information here.
 
Please input expression information here.
 +
 +
Using quantitative RT-PCR(qRT-PCR). TIP2 expression was specifically observed in anthers, from the meiosis stage to mitosis, with a maximum expression
 +
level at stages 7 and 8.Interestingly, tip2 anthers displayed a lower level of TIP2 than the wild type from stage 6 to stage 8, but a higher level than the wild type after stage 9, when young microspores were released.
 +
 +
[[File:tip2.jpg]]
 +
 +
In situ hybridization showed strong expression of TIP2 in the middle layer and tapetum and weak expression in the endothecium in the wild type. By contrast, only background signal was detected in the same anther section with the sense probe.
 +
 +
[[File:tip3.jpg]]
  
 
===Evolution===
 
===Evolution===

Revision as of 11:57, 5 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

TDR INTERACTING PROTEIN2 (TIP2) is a basic helix-loop-helix (bHLH) protein, functions as a crucial switch in the meristemoid transition and differentiation during early anther development.

  • The tip2 mutants display undifferentiated inner three anther wall layers.
  • The tip2 anthers have prolonged periclinal cell division activity after the formation of the inner two anther wall layers via periclinal cell division.
  • The tip2 displayed undegenerated callose around meiocytes, suggesting defective callose degeneration in the tip2 mutant.
  • The tip2 mutants display abort tapetal programmed cell death.


TIP2 acts upstream of TDR and EAT1 and directly regulates the expression of TDR and EAT1, suggested that the bHLH proteins TIP2, TDR, and EAT1 play a central role in regulating differentiation, morphogenesis, and degradation of anther somatic cell layers.

Tip1.jpg

Expression

Please input expression information here.

Using quantitative RT-PCR(qRT-PCR). TIP2 expression was specifically observed in anthers, from the meiosis stage to mitosis, with a maximum expression level at stages 7 and 8.Interestingly, tip2 anthers displayed a lower level of TIP2 than the wild type from stage 6 to stage 8, but a higher level than the wild type after stage 9, when young microspores were released.

Tip2.jpg

In situ hybridization showed strong expression of TIP2 in the middle layer and tapetum and weak expression in the endothecium in the wild type. By contrast, only background signal was detected in the same anther section with the sense probe.

Tip3.jpg

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0293100

Description

Basic helix-loop-helix dimerisation region bHLH domain containing protein

Version

NM_001049330.1 GI:115436073 GeneID:4325164

Length

2112 bp

Definition

Oryza sativa Japonica Group Os01g0293100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:10712748..10714859

Sequence Coding Region

10713003..10713074,10713260..10713712,10713812..10714426

Expression

GEO Profiles:Os01g0293100

Genome Context

<gbrowseImage1> name=NC_008394:10712748..10714859 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:10712748..10714859 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtatcacccgcagtgcgagctcctgatgccgcttgagagcctggagatggacgtcggccagtcgcacctcgccgccgccgtcgcagcagccatgccgggggagctcaacttccacctcctccactcgctcgacgccgccgcggcggctgcctcctccaccgccgcctcggcctcctcccagcccaccgtcgactacttcttcggcggcgccgaccagcagccgccgccgccggcggcgatgcagtacgaccagctggcggcgccgcaccaccaccagacggtggccatgctgcgcgactactacggcggccactacccgccggcggcggcggcggcggcggccaccgaggcgtacttccgcggcgggccaaggacggccgggtcgtcgtcgctcgtgttcggcccggccgacgacgagtcggccttcatggtcggacccttcgagagctccccgacgccgcggtccggcggcggcaggaagcgtagccgcgccaccgccggcttccacggcggcgggccggccaacggcgtcgagaagaaggagaagcagcgccgcctgcggctcaccgagaagtacaacgccctcatgctcctcatccccaaccgcaccaaggaggatagagcgacggtgatctcagacgcgatcgagtacatccaggagctagggaggacggtggaggagctgacgctgctggtggagaagaagcggcggcggagggagatgcagggggacgtggtggacgcggcgacgtcgtcggtggtggcggggatggatcaggcggcggagagctcggagggcgaggtgatggcggcggcggcgatgggcgcggtggcaccgccgccgcggcaggcgccgatccggagcacgtacatccagcggcggagcaaggagacgttcgtggacgtgcggatcgtggaggacgacgtgaacatcaagctcaccaagcgccgccgcgacggctgtctcgccgccgcgtcgcgcgcgctggacgacctccgcctcgacctcgtccacctctccggcggcaagatcggcgactgccacatctacatgttcaacaccaagattcattcgggatctccagtgtttgcaagtgcagtggccagcaggctgattgaagtggtggatgagtactaa</cdnaseq>

Protein Sequence

<aaseq>MYHPQCELLMPLESLEMDVGQSHLAAAVAAAMPGELNFHLLHSL DAAAAAASSTAASASSQPTVDYFFGGADQQPPPPAAMQYDQLAAPHHHQTVAMLRDYY GGHYPPAAAAAAATEAYFRGGPRTAGSSSLVFGPADDESAFMVGPFESSPTPRSGGGR KRSRATAGFHGGGPANGVEKKEKQRRLRLTEKYNALMLLIPNRTKEDRATVISDAIEY IQELGRTVEELTLLVEKKRRRREMQGDVVDAATSSVVAGMDQAAESSEGEVMAAAAMG AVAPPPRQAPIRSTYIQRRSKETFVDVRIVEDDVNIKLTKRRRDGCLAAASRALDDLR LDLVHLSGGKIGDCHIYMFNTKIHSGSPVFASAVASRLIEVVDEY</aaseq>

Gene Sequence

<dnaseqindica>1786..1857#1148..1600#434..1048#aagaaaccaactgctttctcctacccaatatcacccttgccccttttatatactcttcctctcatcaccttctcgatcggcctctctcctctcctctcatcagctcacacccccaaccaacaaacctagttaatttagctctagttggttcatccctgctgcactgcgagctcaagtaatcgatctgagctctgaagaaaaaggtctgtttcaaattgaaccctttcatctcatcttctcattactgtttgattcattaattctagtaatttagagtttaaaccatcgcttttctttttgtgtgtgttcttgcatatgcttggacgattttgagtttgttctttaaatttgggcttgaacataggttgattaagcgagaagagtttcatggtttggattcttgatttgttgcaggtggtagagtgcgaggaagatgtatcacccgcagtgcgagctcctgatgccgcttgagagcctggagatggacgtcggccagtcgcacctcgccgccgccgtcgcagcagccatgccgggggagctcaacttccacctcctccactcgctcgacgccgccgcggcggctgcctcctccaccgccgcctcggcctcctcccagcccaccgtcgactacttcttcggcggcgccgaccagcagccgccgccgccggcggcgatgcagtacgaccagctggcggcgccgcaccaccaccagacggtggccatgctgcgcgactactacggcggccactacccgccggcggcggcggcggcggcggccaccgaggcgtacttccgcggcgggccaaggacggccgggtcgtcgtcgctcgtgttcggcccggccgacgacgagtcggccttcatggtcggacccttcgagagctccccgacgccgcggtccggcggcggcaggaagcgtagccgcgccaccgccggcttccacggcggcgggccggccaacggcgtcgagaagaaggagaagcagcgccgcctgcggctcaccgagaagtacaacgccctcatgctcctcatccccaaccgcaccaaggtatatcacatgccctagctaccatcgtcttcggtagttcgatctcttcttgtgttcatccatggatcgatcgatgatgattttgtctttctttttcaggaggatagagcgacggtgatctcagacgcgatcgagtacatccaggagctagggaggacggtggaggagctgacgctgctggtggagaagaagcggcggcggagggagatgcagggggacgtggtggacgcggcgacgtcgtcggtggtggcggggatggatcaggcggcggagagctcggagggcgaggtgatggcggcggcggcgatgggcgcggtggcaccgccgccgcggcaggcgccgatccggagcacgtacatccagcggcggagcaaggagacgttcgtggacgtgcggatcgtggaggacgacgtgaacatcaagctcaccaagcgccgccgcgacggctgtctcgccgccgcgtcgcgcgcgctggacgacctccgcctcgacctcgtccacctctccggcggcaagatcggcgactgccacatctacatgttcaacaccaaggtcacaacaaccaactaaaaatatccccgcgtttatctacaaaactaaccaatctcataatagtaattaattctagaacaattttatcgtgttgtgatcaacataaacctatatatgcaaataaattgctgctagttaatctcatcattgatttattattgtttatttggatgcgatgcatgcagattcattcgggatctccagtgtttgcaagtgcagtggccagcaggctgattgaagtggtggatgagtactaactagctcgagctagctaattagccgaccgaccgatcgatatgatgaaagtttctatgttgctagctagctagggttcttggatgcatgagtactgagtagctctttaattaatttccttttaattttagactgtttaatttggattggtaaagactcgtgttagcttttgggagatctttggtatgtcatggtttgcatgtattattttggtctacttggataaataattgatgctctttgagacgttaattaat</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0293100, RefSeq:Os01g0293100