Difference between revisions of "Atp9"

From RiceWiki
Jump to: navigation, search
(Undo revision 178405 by Hailin Li (talk))
Line 21: Line 21:
 
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial
 
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial
 
Genome Evolution PLOS Genetics August 2012</ref>
 
Genome Evolution PLOS Genetics August 2012</ref>
==Structured Information==
 
{{Mitochondrion|
 
GeneName = atp9|
 
Description = ATP synthase F0 subunit 9|
 
Version = GeneID:6450130|
 
Length = 225 bp|
 
Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|
 
Source = Oryza sativa Japonica Group
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|
 
AP = Mitochondrion:263141..263365|
 
CDS = 263141..263365|
 
GCID = <gbrowseImage1>
 
name=NC_011033:263141..263365
 
source=Rice_Japonica_Mitochondrion
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_011033:263141..263365
 
source=Rice_Japonica_Mitochondrion
 
preset=GeneLocation
 
</gbrowseImage2>|
 
AA = <aaseq>MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF</aaseq>|
 
DNA = <dnaseqindica>1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/gene?term=6450130 NCBI Gene:atp9]
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Mitochondrion]]
 
[[Category:Mitochondrion]]
 

Revision as of 12:54, 5 June 2014

The rice atp9 sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. [1][2].

Annotated Information

Function

atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants[3]. The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.[2]

Mutation

Expression

Evolution

Labs working on this gene

References

<references> [1] [3]

[2]
  1. 1.0 1.1 Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011
  2. 2.0 2.1 2.2 Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial Genome Evolution PLOS Genetics August 2012
  3. 3.0 3.1 Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from other plants .Plant Molecular Biology 13: 395-397, 1989.