Difference between revisions of "Atp9"

From RiceWiki
Jump to: navigation, search
(Undo revision 178405 by Hailin Li (talk))
Line 1: Line 1:
The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. <ref name="ref1" /><ref name="ref3" />.
 
  
==Annotated Information==
+
{{Mitochondrion|
===Function===
+
GeneName = atp9|
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants<ref name="ref2" />.
+
Description = ATP synthase F0 subunit 9|
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.<ref name="ref3" />
+
Version = GeneID:6450130|
 +
Length = 225 bp|
 +
Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|
 +
Source = Oryza sativa Japonica Group
  
===Mutation===
+
  ORGANISM  Oryza sativa Japonica Group
 
+
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
===Expression===
+
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
===Evolution===
+
            clade; Ehrhartoideae; Oryzeae; Oryza.
==Labs working on this gene==
+
|
 
+
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|
==References==
+
AP = Mitochondrion:263141..263365|
<references>
+
CDS = 263141..263365|
<ref name="ref1">
+
GCID = <gbrowseImage1>
Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011</ref>
+
name=NC_011033:263141..263365
<ref name="ref2">
+
source=Rice_Japonica_Mitochondrion
Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from  other plants .Plant Molecular Biology 13: 395-397, 1989.</ref>
+
preset=GeneLocation
<ref name="ref3">
+
</gbrowseImage1>|
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial
+
GSID = <gbrowseImage2>
Genome Evolution PLOS Genetics August 2012</ref>
+
name=NC_011033:263141..263365
 +
source=Rice_Japonica_Mitochondrion
 +
preset=GeneLocation
 +
</gbrowseImage2>|
 +
AA = <aaseq>MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF</aaseq>|
 +
DNA = <dnaseqindica>1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga</dnaseqindica>|
 +
}}
 +
[[Category:Genes]]
 +
[[Category:Japonica mRNA]]
 +
[[Category:Oryza Sativa Japonica Group]]
 +
[[Category:Japonica Genes]]
 +
[[Category:Japonica Mitochondrion]]
 +
[[Category:Mitochondrion]]

Revision as of 12:57, 5 June 2014

Gene Name

atp9

Description

ATP synthase F0 subunit 9

Version

GeneID:6450130

Length

225 bp

Definition

Oryza sativa Japonica Group atp9, Mitochondrion gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Mitochondrion

Location

Mitochondrion:263141..263365

Sequence Coding Region

263141..263365

Genome Context

<gbrowseImage1> name=NC_011033:263141..263365 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage1>

Gene Structure
(RNA Editing)

<gbrowseImage2> name=NC_011033:263141..263365 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage2>

Protein Sequence

<aaseq>MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF</aaseq>

Gene Sequence

<dnaseqindica>1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga</dnaseqindica>

External Link(s)

{{{Link}}}