Difference between revisions of "Atp9"
| Line 1: | Line 1: | ||
| + | The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. <ref name="ref1" /><ref name="ref3" />. | ||
{{Mitochondrion| | {{Mitochondrion| | ||
Revision as of 12:58, 5 June 2014
The rice atp9 sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. [1][2].
| Gene Name |
atp9 |
|---|---|
| Description |
ATP synthase F0 subunit 9 |
| Version |
GeneID:6450130 |
| Length |
225 bp |
| Definition |
Oryza sativa Japonica Group atp9, Mitochondrion gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Mitochondrion:263141..263365 |
| Sequence Coding Region |
263141..263365 |
| Genome Context |
<gbrowseImage1> name=NC_011033:263141..263365 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage1> |
| Gene Structure (RNA Editing) |
<gbrowseImage2> name=NC_011033:263141..263365 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage2> |
| Protein Sequence |
<aaseq>MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF</aaseq> |
| Gene Sequence |
<dnaseqindica>1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga</dnaseqindica> |
| External Link(s) |
{{{Link}}} |