Difference between revisions of "Os06g0181700"
Wangshuqin (talk | contribs) (→Function) |
Wangshuqin (talk | contribs) (→References) |
||
| Line 18: | Line 18: | ||
An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice | An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice | ||
Plant Molecular Biology, 2012, 78(3): 275-288 | Plant Molecular Biology, 2012, 78(3): 275-288 | ||
| + | Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A | ||
| + | The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480 | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
Revision as of 13:12, 5 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
References
Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice Plant Molecular Biology, 2012, 78(3): 275-288
Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480
Labs working on this gene
Please input related labs here.
Structured Information
| Gene Name |
Os06g0181700 |
|---|---|
| Description |
Pathogenesis-related transcriptional factor and ERF domain containing protein |
| Version |
NM_001063516.1 GI:115466763 GeneID:4340313 |
| Length |
980 bp |
| Definition |
Oryza sativa Japonica Group Os06g0181700, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:4039785..4040764 |
| Sequence Coding Region |
4039909..4039991,4040099..4040552 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:4039785..4040764 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:4039785..4040764 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga</cdnaseq> |
| Protein Sequence |
<aaseq>MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC</aaseq> |
| Gene Sequence |
<dnaseqindica>125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc</dnaseqindica> |
| External Link(s) |