Difference between revisions of "Atp9"
| Line 4: | Line 4: | ||
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants<ref name="ref2" />. | atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants<ref name="ref2" />. | ||
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.<ref name="ref3" /> | The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.<ref name="ref3" /> | ||
| − | + | ||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
== Structured Information == | == Structured Information == | ||
{{Mitochondrion| | {{Mitochondrion| | ||
Revision as of 13:23, 5 June 2014
The rice atp9 sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. [1][2].
Annotated Information
Function
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants[3]. The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.[2]
Structured Information
| Gene Name |
atp9 |
|---|---|
| Description |
ATP synthase F0 subunit 9 |
| Version |
GeneID:6450130 |
| Length |
225 bp |
| Definition |
Oryza sativa Japonica Group atp9, Mitochondrion gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Mitochondrion:263141..263365 |
| Sequence Coding Region |
263141..263365 |
| Genome Context |
<gbrowseImage1> name=NC_011033:263141..263365 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage1> |
| Gene Structure (RNA Editing) |
<gbrowseImage2> name=NC_011033:263141..263365 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage2> |
| Protein Sequence |
<aaseq>MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF</aaseq> |
| Gene Sequence |
<dnaseqindica>1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga</dnaseqindica> |
| External Link(s) |
{{{Link}}} |