Difference between revisions of "Atp9"

From RiceWiki
Jump to: navigation, search
m (moved Atp9 to Atp9a)
(No difference)

Revision as of 13:41, 5 June 2014

The rice atp9 sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. [1][2].

Annotated Information

Function

atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants[3]. The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.[2]

Mutation

Please Mutation information here

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

<references> [1] [3]

[2]

Structured Information

Gene Name

atp9

Description

ATP synthase F0 subunit 9

Version

GeneID:6450130

Length

225 bp

Definition

Oryza sativa Japonica Group atp9, Mitochondrion gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Mitochondrion

Location

Mitochondrion:263141..263365

Sequence Coding Region

263141..263365

Genome Context

<gbrowseImage1> name=NC_011033:263141..263365 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage1>

Gene Structure
(RNA Editing)

<gbrowseImage2> name=NC_011033:263141..263365 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage2>

Protein Sequence

<aaseq>MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF</aaseq>

Gene Sequence

{{{DNA}}}

External Link(s)

{{{Link}}}

[[Category:Mitochondrion]
  1. 1.0 1.1 Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011
  2. 2.0 2.1 2.2 Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial Genome Evolution PLOS Genetics August 2012
  3. 3.0 3.1 Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from other plants .Plant Molecular Biology 13: 395-397, 1989.