Difference between revisions of "Os01g0771200"

From RiceWiki
Jump to: navigation, search
(Expression)
Line 10: Line 10:
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
  The XB24 cDNAis expressed from a unique rice gene, Os01g56470 (Fig. S1A), and encodes a 198-aa protein. The predicted secondarystructure has no significant
 +
motifs except for a C-terminal ATP synthase α-and β-subunits signature (ATPase) motif with the sequence PSINERESSS (Fig. S1B). Although 38 human proteins,
 +
43 Arabidopsis proteins, and 67 additional rice proteins are annotated to contain a conserved ATPase motif (Fig. S2), none share similarity beyond the ATPase
 +
motif with XB24 and most are not functionally characterized. Thus, XB24 belongs to a previously uncharacterized class of ATPases.The only conserved structure
 +
in XB24 is the region composed of 10 amino acids PSINERES154SS (Fig. S1B) that is predicted as the ATPase motif, (P-[SAP]-[LIV]-[DNH]-{LKGN}-{F}-{S}-S-{DCPH}
 +
-S) (Fig. S1C).
 +
  Silencing of Xb24 Enhances Xa21-Mediated Resistance.
 +
  Overexpression of XB24 Compromises XA21-Mediated Resistance.
  
 
===Evolution===
 
===Evolution===

Revision as of 13:50, 5 June 2014

XB24 is a unique ATPase from a previously unclassified subclass. It does not belong to any of these previously described superfamilies of ATPases or HSPs.

Annotated Information

Function

  • XB24 promotes autophosphorylation of XA21 through its ATPase activity. Rice lines silenced for Xb24 display enhanced XA21-mediated immunity, whereas rice

lines overexpressing XB24 are compromised for immunity. XB24 ATPase enzyme activity is required for XB24 function. XA21 is degraded in the presence of the pathogen-associated molecular pattern Ax21 when XB24 is overexpressed.

  • To be more specifically, ①XB24 ATPase enhances autophosphorylation of XA21K668.②Silencing of Xb24 enhances xa21-Mediated resistance. The author used the RNA interference (RNAi) approach (26, 27) to silence the Xb24 gene and monitored its effects on disease resistance. Then they developed two independent lines,Xb24RNAi-3 andXb24RNAi-9, each containing a single-locus insertion, using the rice cultivar Kitaake as the transgene recipient. RT-PCR analysis revealed that Xb24 transcript levels were significantly reduced in these two lines (Fig. S7A). Both lines show similar disease lesion lengths compared to the control line Kitaake after challenge with PXO99 (Fig. S7B), indicating that silencing of Xb24 does not affect the susceptibility of Kitaake to Xoo.③Overexpression of XB24 compromises XA21-Mediated resistance and causes XA21 instability following ax21 recognition. To further investigate the involvement ofXB24 in theXA21-mediated signaling, we created construct Ubi-Xb24 to overexpress XB24 using the maize Ubi-1 promoter. We introduced the Ubi-Xb24 construct directly into an Xa21 (in the TP309 genetic background) line by Agrobacterium-mediated transformation using mannose selection (29) and generated five independent T0 plants. After PCR-based genotyping and RT-PCR-based transcripts expression analyses to confirm that Xb24 is overexpressed, we challenged 6-week-oldXa21 lines withPXO99.Wefound that all of thefive lines have longer disease lesion lengths compared with the wild-type

Xa21 plants (Fig. S8).Overexpression of XB24 (XB24ox) in the progeny from these homozygous lines was confirmed by protein gel blotting analysis.Rice lines overexpressing Xb24 display similar levels of susceptibility as control lines lacking overexpressed Xb24 in three independent biological replicates (Fig. S8).

Expression

  The XB24 cDNAis expressed from a unique rice gene, Os01g56470 (Fig. S1A), and encodes a 198-aa protein. The predicted secondarystructure has no significant
motifs except for a C-terminal ATP synthase α-and β-subunits signature (ATPase) motif with the sequence PSINERESSS (Fig. S1B). Although 38 human proteins,
43 Arabidopsis proteins, and 67 additional rice proteins are annotated to contain a conserved ATPase motif (Fig. S2), none share similarity beyond the ATPase
motif with XB24 and most are not functionally characterized. Thus, XB24 belongs to a previously uncharacterized class of ATPases.The only conserved structure
in XB24 is the region composed of 10 amino acids PSINERES154SS (Fig. S1B) that is predicted as the ATPase motif, (P-[SAP]-[LIV]-[DNH]-{LKGN}-{F}-{S}-S-{DCPH}
-S) (Fig. S1C).
  Silencing of Xb24 Enhances Xa21-Mediated Resistance. 
  Overexpression of XB24 Compromises XA21-Mediated Resistance.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0771200

Description

Similar to Mal d 1-associated protein

Version

NM_001050918.1 GI:115440206 GeneID:4324614

Length

1888 bp

Definition

Oryza sativa Japonica Group Os01g0771200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:34299150..34301037

Sequence Coding Region

34299283..34299494,34300420..34300804

Expression

GEO Profiles:Os01g0771200

Genome Context

<gbrowseImage1> name=NC_008394:34299150..34301037 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:34299150..34301037 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggttggcgttggcacgacgacggcgatgacggcggccgcggcctgggcgacatccccgacctcgccggcggcggcggaggcggagatggggagcgctgcgccacgcgccgggtggtgcagtctcggtgccacacggaggaggtggagcccggccgcttcgtccgcaagtgcgagaagaccgagcagctcctccgcgactgcgtcggcaggccctctgaactggtggaatcaaaaactgaaaatactgaagaagacgtcacagatgaaatgaaaagcgggtcactatctcttggttttccgaccaatgagccctttgcatttcctggacttcgcagtgacatagaagctcttgagaaaggccttttcgggagcattggtagctttctggatgatgctgagaggatgaccaatgatttcttgaagtcttttggtgtcccttccatcaatgaaagggagtcgagctcatttgatggacaacctacaggcaggcacattggtggacaacctgcaggcaggcacattgaggaaggtactgcaaaggacactaaacagaacgactacgcagaattcagcagcaagattacagatgtgtaa</cdnaseq>

Protein Sequence

<aaseq>MGWRWHDDGDDGGRGLGDIPDLAGGGGGGDGERCATRRVVQSRC HTEEVEPGRFVRKCEKTEQLLRDCVGRPSELVESKTENTEEDVTDEMKSGSLSLGFPT NEPFAFPGLRSDIEALEKGLFGSIGSFLDDAERMTNDFLKSFGVPSINERESSSFDGQ PTGRHIGGQPAGRHIEEGTAKDTKQNDYAEFSSKITDV</aaseq>

Gene Sequence

<dnaseqindica>134..345#1271..1655#agaaacgagccggccggattgctctccaagccaaacacggcccagagaggcgagagcccccacaccgccaaacccgacccggaaatcaactgcacacgctccgatcccctctctccagatcgattcggaccccatgggttggcgttggcacgacgacggcgatgacggcggccgcggcctgggcgacatccccgacctcgccggcggcggcggaggcggagatggggagcgctgcgccacgcgccgggtggtgcagtctcggtgccacacggaggaggtggagcccggccgcttcgtccgcaagtgcgagaagaccgagcagctcctccgcgactgcgtcggcaggtatatacatatactccatggcctcgcgcttttccctgatctgttccttcttttcctgcgaggatcccctctttgcatattactgttcgttgttttagtgatgaattggtgataacatgtcatgcgcagttgtgttactattagtcccgtgtatgattgtgagctgtgtatagccgcctctctgtggacgattttcgtgagtctgtcctcgctgatttgatacaaacacgaattcattaagaatggggaatgtgccgtgatgatcgagacgtttgagttctgtggtgaatagtatgatcaaatgtgtgtaataacttgggcttttgaattttggtagctaattagatatggaatttctatccagttttaggtgcccgtgccatcgacatgggttaaaagttattgtgggctattttgcgctcaacttgttaatcaacaaattttggacggaggcagtactttgtaggcatggggtaaatttgtatgatacacttgttgcttgaagatgttcgtgaactcatgggatttctagacacctacaaccaattacattacagtgttattatattctaacgatatgtaaagagcagctgtgttcgtgttgtctacactaaagattcaacaactagtggtcatcatcaaaccgatagcatatcctcattttgcaggattttgaaaactcacatctcgttagcatccttccttttatttcttcacatgcctcatgttaaacttttaagtgcatgaaacccaaatttctgtatttcgtagctccttgtaaccaatgtacaacactatgattagtattctggatagattttgtacttcccaaagtattttggttgttgacaagctattacaataatctgatggataacctaccatacattatttctcctaaccgatcacaataatcttcttctaggccctctgaactggtggaatcaaaaactgaaaatactgaagaagacgtcacagatgaaatgaaaagcgggtcactatctcttggttttccgaccaatgagccctttgcatttcctggacttcgcagtgacatagaagctcttgagaaaggccttttcgggagcattggtagctttctggatgatgctgagaggatgaccaatgatttcttgaagtcttttggtgtcccttccatcaatgaaagggagtcgagctcatttgatggacaacctacaggcaggcacattggtggacaacctgcaggcaggcacattgaggaaggtactgcaaaggacactaaacagaacgactacgcagaattcagcagcaagattacagatgtgtaaggatctacagttagctgacgcacctttgggagcagcttgccaattttgtattttgaacatctccatggttgtaattggaaggggaaggatcagtttgactgttttataagcagagtcgtctgaagtctgaagtgttgcgcttataagaacaattgtgtatattactgttttagataagcctgtttgtgttcctcaacaatgagatcaattatggatggtttttttctctgctt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0771200, RefSeq:Os01g0771200