Difference between revisions of "Os01g0848400"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
Line 1: Line 1:
 
Please input one-sentence summary here.
 
Please input one-sentence summary here.
  
==Annotated Information==
+
Molecular cloning of major quantitative trait loci (QTLs) responsible for the reduction of rice grain shattering, a hallmark of cereal domestication, provided opportunities for in-depth investigation of domestication processes.
===Function===
+
Here, we studied nucleotide variation at the shattering loci, sh4 and qSH1, for cultivated rice, Oryza sativa ssp. indica and Oryza sativa ssp. japonica, and the wild progenitors, Oryza nivara andOryza rufipogon.
Please input function information here.
+
The nonshattering sh4 allele was fixed in all rice cultivars, with levels of sequence polymorphism significantly reduced in both indica and japonica cultivars relative to the wild progenitors. The sh4 phylogeny together with the neutrality tests and coalescent simulations suggested that sh4 had a single origin and was fixed by artificial selection during the domestication of rice. Selection on qSH1 was not detected in indica and remained unclear in japonica.
 
+
Selection on sh4 could be strong enough to have driven its fixation in a population of cultivated rice within a period of c. 100 yr. The slow fixation of the nonshattering phenotype observed at the archeological sites might be a result of relatively weak selection on mutations other than sh4 in early rice cultivation. The fixation of sh4 could have been achieved later through strong selection for the optimal phenotype.
===Expression===
 
Please input expression information here.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 15:00, 5 June 2014

Please input one-sentence summary here.

Molecular cloning of major quantitative trait loci (QTLs) responsible for the reduction of rice grain shattering, a hallmark of cereal domestication, provided opportunities for in-depth investigation of domestication processes. Here, we studied nucleotide variation at the shattering loci, sh4 and qSH1, for cultivated rice, Oryza sativa ssp. indica and Oryza sativa ssp. japonica, and the wild progenitors, Oryza nivara andOryza rufipogon. The nonshattering sh4 allele was fixed in all rice cultivars, with levels of sequence polymorphism significantly reduced in both indica and japonica cultivars relative to the wild progenitors. The sh4 phylogeny together with the neutrality tests and coalescent simulations suggested that sh4 had a single origin and was fixed by artificial selection during the domestication of rice. Selection on qSH1 was not detected in indica and remained unclear in japonica. Selection on sh4 could be strong enough to have driven its fixation in a population of cultivated rice within a period of c. 100 yr. The slow fixation of the nonshattering phenotype observed at the archeological sites might be a result of relatively weak selection on mutations other than sh4 in early rice cultivation. The fixation of sh4 could have been achieved later through strong selection for the optimal phenotype.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0848400

Description

Acid phosphatase/vanadium-dependent haloperoxidase family protein

Version

NM_001051339.1 GI:115441048 GeneID:4324855

Length

4496 bp

Definition

Oryza sativa Japonica Group Os01g0848400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:38201303..38205798

Sequence Coding Region

38201457..38202047,38202155..38202215,38203339..38203718,38204543..38205349

Expression

GEO Profiles:Os01g0848400

Genome Context

<gbrowseImage1> name=NC_008394:38201303..38205798 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:38201303..38205798 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtcgtccgccgctgggggcggcgggtacggcggcggccagggtggaggcgcggagcaccaccaccaccaccacgggcacgccggtcacctcctgctccaccaccatccgcagcacgtggccggcgcggccgttgcggcagcggccgcggcggcgggcgggcagatgtaccacgtgccccagcacagccggcgcgagaagctccggttcccgccggacgccggggactcgccaccgcctcatggtcatggtcatggtcatgccccgcagcagcagcagcagcacgggtcgtggcctccgcccccggcgttctactcgtacgcgtcctcgtcgtcgtcgtactccccgcacagccctactctagcgcaggcgcagctggtggcgcacgggctggcgccgccgctcccgcagatcccgacgcagaacttctcgctgtcgctctcctccgcgtcgtcgaatcctccaccaccgcaggcgcagccgaggaggcagctcggcggcctcgcgcaggccacggggccgttcggtcccttcaccggctacgccgccgtgctcggccggtcccgtttcctcggcccggcagagaagctgttcgaggagatctgcgacgtcggcggcgctgcttcgcacgtcgaccgcaccatctccgacgagggcctgctcgacgcggatccgatggacggcgtcgatcatgacgtcgttgatcacgacctcggcggcgctgaccgcgcagcggccgacgctggccccatctcgggggccgagcagcagtggaagaagacgaagctcatctccatgatggaagaggtttgcaagaggtaccggcagtactaccagcaggttcaggctgtgatggcctcgttcgagaccgtcgccgggttcagcaacgccgcgccgttcgcggcattggcgctgagggcgatggcgaagcacttcaagtgcttgaagagcatgattctgaaccagctgcgcaacacgagcaacaaggtcgctgtgaaggacgggctaaacaaggagatcgccgtgttcgggctcgccgggggtagcagcggcggcgccggcctccagcgagcgaacagcgcgagcgcgttcggccagccgcacaatatttggcgcccacagagggggctccccgagcgcgctgtgtccgttttacgcgcgtggctgttcgaacacttcctgcacccgtatcctaccgatggtgataagcaaatgctagcaaaacaaacaggcttgacacgcaaccaggtatcgaactggtttatcaacgcaagggttaggttgtggaagccaatggtggaagaaattcacaacctagagatgaggcaaatgcacaagcactcggtggttgacaagggccagcatagcgtgcatcatcaggcccagcattcttcgcagtgcagcgggaatccctccgttccttcggactcccatcctggacagagcagcagcataactcggaaccacaacaccgctgcctcccagggcttcccggatgagctctcccagatgtcccagtccatccagggacaggtgagcttcgcatacaacgggctgacctcgcagcacaacattgcatcaccacatcatcagcaccagcaggtcggcggtgttggtatcggaggcggcaatggcggtgtctccctcacccttggtcttcaccagaacaacagggtctgcatcgccgagcctctcccggctgctctcccggccaacctagctcaccgtttcggactggaggaagtcagtgacgcctatgtgatgagctcatttggaggtcaggaccggcatttcgggaaggagattggtggtcacttgctgcatgattttgtcgggtga</cdnaseq>

Protein Sequence

<aaseq>MSSAAGGGGYGGGQGGGAEHHHHHHGHAGHLLLHHHPQHVAGAA VAAAAAAAGGQMYHVPQHSRREKLRFPPDAGDSPPPHGHGHGHAPQQQQQHGSWPPPP AFYSYASSSSSYSPHSPTLAQAQLVAHGLAPPLPQIPTQNFSLSLSSASSNPPPPQAQ PRRQLGGLAQATGPFGPFTGYAAVLGRSRFLGPAEKLFEEICDVGGAASHVDRTISDE GLLDADPMDGVDHDVVDHDLGGADRAAADAGPISGAEQQWKKTKLISMMEEVCKRYRQ YYQQVQAVMASFETVAGFSNAAPFAALALRAMAKHFKCLKSMILNQLRNTSNKVAVKD GLNKEIAVFGLAGGSSGGAGLQRANSASAFGQPHNIWRPQRGLPERAVSVLRAWLFEH FLHPYPTDGDKQMLAKQTGLTRNQVSNWFINARVRLWKPMVEEIHNLEMRQMHKHSVV DKGQHSVHHQAQHSSQCSGNPSVPSDSHPGQSSSITRNHNTAASQGFPDELSQMSQSI QGQVSFAYNGLTSQHNIASPHHQHQQVGGVGIGGGNGGVSLTLGLHQNNRVCIAEPLP AALPANLAHRFGLEEVSDAYVMSSFGGQDRHFGKEIGGHLLHDFVG</aaseq>

Gene Sequence

<dnaseqindica>3752..4342#3584..3644#2081..2460#450..1256#cggcctttctgctttcgctttcacagtttcacggcttaccatttccttcccatctctccctcccgccacccccctctttctccccctccgtgtctcgcctttgcagaaagaaaggcgccacgaacccagcaacaacacccagcacaaaggcgaaacggggaaaaagaggaggaaaacaacaagaggacgcgaggggtcggggtgggagagggaggctacactacagcagcagcagaagcagagcgggagagtgatgagggagtgagaccaggccagccaagccaggcccgggcgctcggaaagtgcggagccgtttcccctctatctccactctctccagggccaggtgctcactgcgctgcgcctcttcgcacgcaccacccgtactacgtgcccacccgcgcgcgcgccgaggagaagagacccacgaccgtacgtgcgtgcgcgccatgtcgtccgccgctgggggcggcgggtacggcggcggccagggtggaggcgcggagcaccaccaccaccaccacgggcacgccggtcacctcctgctccaccaccatccgcagcacgtggccggcgcggccgttgcggcagcggccgcggcggcgggcgggcagatgtaccacgtgccccagcacagccggcgcgagaagctccggttcccgccggacgccggggactcgccaccgcctcatggtcatggtcatggtcatgccccgcagcagcagcagcagcacgggtcgtggcctccgcccccggcgttctactcgtacgcgtcctcgtcgtcgtcgtactccccgcacagccctactctagcgcaggcgcagctggtggcgcacgggctggcgccgccgctcccgcagatcccgacgcagaacttctcgctgtcgctctcctccgcgtcgtcgaatcctccaccaccgcaggcgcagccgaggaggcagctcggcggcctcgcgcaggccacggggccgttcggtcccttcaccggctacgccgccgtgctcggccggtcccgtttcctcggcccggcagagaagctgttcgaggagatctgcgacgtcggcggcgctgcttcgcacgtcgaccgcaccatctccgacgagggcctgctcgacgcggatccgatggacggcgtcgatcatgacgtcgttgatcacgacctcggcggcgctgaccgcgcagcggccgacgctggccccatctcgggggccgagcagcagtggaagaagacgaagctcatctccatgatggaagaggtgagtgagctccgctagccgcctcaattcctccttccaggtttcttgtggcgaccatctttttcaccttgtttcggcgttacaattatcgctactcctgggtggagaagaatcttgcacatagtggtcatgtcaccgatgcagttgcggattgcttttatttactgtggttgcatgtgcttttgatttgatgatgatttcctttgctgctgatacatcttttgatttgttctctctcttctttttcctcgagtggtttgagcttgtacagttctgcactgttcatgatgaatagtagtgttcctccgcgtcttatcaccaaagattgtattttgatcggctgtttagcactactgtgagtgcttgaaaagatagtcctccacatgaaattagaactaaccgtcctttcaaagtcttgagacatgacccatgggcgatgccagatgccattaattctctcttgttggtgtcctctggtgagaatagtggcgctgctaaaagcttcgagctttgaaatgcgctctcctctacgatgtcggagcatggcaattaggagtatactacatgagcatctacgtaggagtacaatgtagaaagcttctatttttggaaccctctgtaaggcaattttgtttgcctgtgttcttcaataacatctctctcccataattgggagctacgcttgctttgttcgtgtcatatccacatgaaaacaaaagcacactgcttccttttcctaacatggatatctttttatctaatcattctttgttggtagattatctctcatcgaattctaacccaacagcaatatctttttttaggtttgcaagaggtaccggcagtactaccagcaggttcaggctgtgatggcctcgttcgagaccgtcgccgggttcagcaacgccgcgccgttcgcggcattggcgctgagggcgatggcgaagcacttcaagtgcttgaagagcatgattctgaaccagctgcgcaacacgagcaacaaggtcgctgtgaaggacgggctaaacaaggagatcgccgtgttcgggctcgccgggggtagcagcggcggcgccggcctccagcgagcgaacagcgcgagcgcgttcggccagccgcacaatatttggcgcccacagagggggctccccgagcgcgctgtgtccgttttacgcgcgtggctgttcgaacacttcctgcacccgtaagccctttgatcttcttattgctttatggttaactctgggttcattagctgcacgcattccaagacaatgatgatgatgctacagttgcttgctttagatgaggataacagtagtccctaagcatttgtggtgagtgtggttgttcctttttgatatgatcagtagtacgtgacactggaaccgtggggttgatccgttgatggtttggtgatagcaagcgaccctgcctgtctgatagaaggctatggcctcatgcaggcatggcttccaatccatcattaacataacttttaaacctgtacctaactgtgtgttgagctgtactactagagatcatactttcgacttggtgatctaaatagtggcattcctgctgcttgtttgatgcattcttaatcacgtattaacttcctggatttgttgtttctggctgtaatgtatgaatgtggtggcccggcttctcataagtagagtggcttttagaacacgttaatgctggaattaacttgccagatgggcattacttcgaactaaatcttaaaagtacataccttaggctataataagcatcatcataatgtagtttgtttggcatattctttttagtttttgtagtatgatcattttgcattatatatatgatctaaaggctgtagctaagccctactggtggttacatcaagttgattgacatgtgctcgagatattcagtttgagataattagtacagtagtttagtgctagccattttcatccagtaaggggtttgtctgtctgtttattactttaaaaaaaggatcagtcatcatctttaaaaaaagtcactgaaatccattatttgtcagatgttggtcctagtgttattagttcccgtattgatcaaatcctttgtaaggttcgacttggaagatgtgtttgcctacatctttgcttggatattcgccatgtaaaatatttgttgtgatcctgtaaaccatcgttaagcatgcacatcacaagtgtcttttgtaatagcggaaatttcttgattatttgattttgcgctatatctggtactttgttcttttagaaaacactataattttgcatcagtgacattttcagattccaatcgtgcaggtatcctaccgatggtgataagcaaatgctagcaaaacaaacaggcttgacacgcaaccaggtaaatagaaatgcttctaggtgtgttcaagaatagattgcacagtatatcaggctagattgttttgttttcaggacattttgattgaatttgtgatgctggtgcaggtatcgaactggtttatcaacgcaagggttaggttgtggaagccaatggtggaagaaattcacaacctagagatgaggcaaatgcacaagcactcggtggttgacaagggccagcatagcgtgcatcatcaggcccagcattcttcgcagtgcagcgggaatccctccgttccttcggactcccatcctggacagagcagcagcataactcggaaccacaacaccgctgcctcccagggcttcccggatgagctctcccagatgtcccagtccatccagggacaggtgagcttcgcatacaacgggctgacctcgcagcacaacattgcatcaccacatcatcagcaccagcaggtcggcggtgttggtatcggaggcggcaatggcggtgtctccctcacccttggtcttcaccagaacaacagggtctgcatcgccgagcctctcccggctgctctcccggccaacctagctcaccgtttcggactggaggaagtcagtgacgcctatgtgatgagctcatttggaggtcaggaccggcatttcgggaaggagattggtggtcacttgctgcatgattttgtcgggtgattgtggctgctgcctcaggttgctggtgatgcacttgtaatgtactgctagtatgatgttaggatggtatataagtcaatcacttggcgacatggcttgatgatcagtctgaatcaatttgttcggagggtgaaaaaacattgatcttcccttc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0848400, RefSeq:Os01g0848400