Difference between revisions of "OrfB"
| Line 1: | Line 1: | ||
| + | Please input one-sentence summary here. | ||
| + | |||
| + | ==Annotated Information== | ||
| + | ===Function=== | ||
| + | The products of the mitochondrial orfB genes are FO components in the plant F1FO ATP synthase. ATP synthase in the plant mitochondrial endomembrane consists of F O and F1 parts and plays an important role in energy formation. As the intramembrane compartment of the enzyme, FO consisting of four subunits, orf25, orfB, atp6 and atp9, and functions as a transporter of H+ through the membrane. Changes in DNA sequence within the atp6 and atp9 genes, as well as in their upstream or downstream regions, were known to be closely related to male sterility in plants. | ||
{{Mitochondrion| | {{Mitochondrion| | ||
GeneName = orfB| | GeneName = orfB| | ||
Revision as of 15:13, 5 June 2014
Please input one-sentence summary here.
Annotated Information
Function
The products of the mitochondrial orfB genes are FO components in the plant F1FO ATP synthase. ATP synthase in the plant mitochondrial endomembrane consists of F O and F1 parts and plays an important role in energy formation. As the intramembrane compartment of the enzyme, FO consisting of four subunits, orf25, orfB, atp6 and atp9, and functions as a transporter of H+ through the membrane. Changes in DNA sequence within the atp6 and atp9 genes, as well as in their upstream or downstream regions, were known to be closely related to male sterility in plants.
| Gene Name |
orfB |
|---|---|
| Description |
ORFB protein |
| Version |
GeneID:6450152 |
| Length |
468 bp |
| Definition |
Oryza sativa Japonica Group orfB, Mitochondrion gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Mitochondrion:53424..53891 |
| Sequence Coding Region |
53424..53891 |
| Genome Context |
<gbrowseImage3> name=NC_011033:53424..53891 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage3> |
| Gene Structure (RNA Editing) |
<gbrowseImage2> name=NC_011033:53424..53891 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage2> |
| Protein Sequence |
<aaseq>MPQLDKLTYFSQFFWLCLFFFSFYILLLNNNNGILGISRILKLRNQLLSHRGNKIRFKDPKNLEDILRKGFSTGLSYMYSSLSEVSQWCKTVDYLGKRRKITLISDFGEISGSRGMERQILYLISKSSYNTSSSRITCWKKIMLTHVLHGQGSII</aaseq> |
| Gene Sequence |
<dnaseqindica>1..468#atgcctcaacttgataaattgacttatttctcacaattcttctggttatgccttttcctctttagtttttatattctcttattaaataataataatggaatacttggaattagcagaattctcaaactacggaaccaactgctttcgcaccgggggaacaagatccgtttcaaggaccctaagaatttggaagatatctcgagaaaaggttttagcaccggtctctcatatatgtactccagtttatccgaagtatcccaatggtgtaagaccgtcgactatttgggaaaaaggaggaaaatcactctgatctcagatttcggagaaataagtggctcacgaggaatggagagacagattctctatttgatctcgaagtcctcatataacacttcttccagtcggatcacttgttggaaaaaaataatgctcacacatgttccacacgggcaaggaagcataatctaa</dnaseqindica> |
| External Link(s) |
