Difference between revisions of "Os05g0154700"

From RiceWiki
Jump to: navigation, search
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
The causal gene of a novel small and round seed mutant phenotype (srs3) in rice was identified by map-based cloning and named the SRS3 gene. The SRS3 gene was grouped as a member of the kinesin 13 subfamily. The SRS3 gene codes for a protein of 819 amino acids that contains a kinesin motor domain and a coiled-coil structure. Using scanning electron microscopy, we determined that the cell length of seeds in the longitudinal direction in srs3 is shorter than that in the wild type. The number of cells of seeds in the longitudinal direction in srs3 was not very different from that in the wild type. The result suggests that the small and round seed phenotype of srs3 is due to a reduction in cell length of seeds in the longitudinal direction. The SRS3 protein, which is found in the crude microsomal fraction, is highly expressed in developing organs.
  
 
===Expression===
 
===Expression===

Revision as of 16:08, 5 June 2014

Please input one-sentence summary here.

Annotated Information

Function

The causal gene of a novel small and round seed mutant phenotype (srs3) in rice was identified by map-based cloning and named the SRS3 gene. The SRS3 gene was grouped as a member of the kinesin 13 subfamily. The SRS3 gene codes for a protein of 819 amino acids that contains a kinesin motor domain and a coiled-coil structure. Using scanning electron microscopy, we determined that the cell length of seeds in the longitudinal direction in srs3 is shorter than that in the wild type. The number of cells of seeds in the longitudinal direction in srs3 was not very different from that in the wild type. The result suggests that the small and round seed phenotype of srs3 is due to a reduction in cell length of seeds in the longitudinal direction. The SRS3 protein, which is found in the crude microsomal fraction, is highly expressed in developing organs.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os05g0154700

Description

Similar to Kinesin heavy chain (Fragment)

Version

NM_001061219.1 GI:115462168 GeneID:4337845

Length

2667 bp

Definition

Oryza sativa Japonica Group Os05g0154700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:3185563..3188229

Sequence Coding Region

3185564..3185877,3185953..3186171,3186268..3186886,3186965..3187030,3187545..3187727

Expression

GEO Profiles:Os05g0154700

Genome Context

<gbrowseImage1> name=NC_008398:3185563..3188229 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:3185563..3188229 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>ggcaagaaacaagtttgcattgttggtctgcaagaatttgaggtttctgatgttcagattgtcaaggaatatattgagagaggaaatgcagcccggagtacagggtcaacaggggccaatgaagaatcatcaaggtcacatgctattctgcagctggctatcaagaaacatatcatagtaactgataccaggcgacaaagagatcgagatgctaatgaatctaaaaacacaaaggctgtgggaaaaatttcatttattgatcttgctggaagcgagcgtggagccgatacaacagacaatgataggcagacgagaattgaaggagctgagataaacaagagcctgctcgctctgaaggaatgcattcgggcccttgataacgatcagatacacattcctttcagaggaagcaagcttacagaagttcttcgtgattcatttgttggtaactctaggacggtgatgatctcttgcatttctccaaatgcaggttcatgtgaacacacattaaataccttgagatatgctgacagggttaaaagtctctcaaagggcagcaatacaagaaaagagcagcccactgggccaactataccttccagcaaggattcttcatctgccccttcatatcctatgcccatcgaaactgaggaaattgccaaccagattcaagagaagagacctgttgaaacttctaggaaggctgctgaaaatttcacctcgaactcttctatggaacctgacaggaatcctgttagtatgattccaagttattctaatagaggaaaagaagaaaatggttcatctggcttgaatgacagagaacgggttgatctgaattccagtcgaattagctacaacagtaaaccacagtctgttcagagttcagcaaatttacaagaagaggaaaaggttacaaaagtttctcctcctcggagaaaggcctatagggatgacaaacctgaaaggcagagcaactatgcgaagaaggatagtggacctgagacaagtaggcctgggtataaggtgcagcaggcaaagcagttgcaacagcaacaacggccgacatctgcttcagcttctcagaattcatcaaggcaatctgaaaaggaaagttcttgtgatgatgtggaaatagatgctattcttgaggaagaggaggctctcatagcagcacacaggaaggaaatcgagaacactatggagattgtacgagaagagatgaaccttttggcagaagttgaccagccagggagccttattgacaactatgtaacacaactgagttttcttctgtcacgcaaggctgctggcttggtcagcctccaagcacgcctggcgcggtttcagcatcgcctcaaagagcaggagatactcagccgtaagaaatcttccagataa</cdnaseq>

Protein Sequence

<aaseq>GKKQVCIVGLQEFEVSDVQIVKEYIERGNAARSTGSTGANEESS RSHAILQLAIKKHIIVTDTRRQRDRDANESKNTKAVGKISFIDLAGSERGADTTDNDR QTRIEGAEINKSLLALKECIRALDNDQIHIPFRGSKLTEVLRDSFVGNSRTVMISCIS PNAGSCEHTLNTLRYADRVKSLSKGSNTRKEQPTGPTIPSSKDSSSAPSYPMPIETEE IANQIQEKRPVETSRKAAENFTSNSSMEPDRNPVSMIPSYSNRGKEENGSSGLNDRER VDLNSSRISYNSKPQSVQSSANLQEEEKVTKVSPPRRKAYRDDKPERQSNYAKKDSGP ETSRPGYKVQQAKQLQQQQRPTSASASQNSSRQSEKESSCDDVEIDAILEEEEALIAA HRKEIENTMEIVREEMNLLAEVDQPGSLIDNYVTQLSFLLSRKAAGLVSLQARLARFQ HRLKEQEILSRKKSSR</aaseq>

Gene Sequence

<dnaseqindica>2..315#391..609#706..1324#1403..1468#1983..2165#tggcaagaaacaagtttgcattgttggtctgcaagaatttgaggtttctgatgttcagattgtcaaggaatatattgagagaggaaatgcagcccggagtacagggtcaacaggggccaatgaagaatcatcaaggtcacatgctattctgcagctggctatcaagaaacatatcatagtaactgataccaggcgacaaagagatcgagatgctaatgaatctaaaaacacaaaggctgtgggaaaaatttcatttattgatcttgctggaagcgagcgtggagccgatacaacagacaatgataggcagacgaggtgataattttttatcttacttttccttgttgcctgtattttctaactattgacctgcaacttttgttttctcagaattgaaggagctgagataaacaagagcctgctcgctctgaaggaatgcattcgggcccttgataacgatcagatacacattcctttcagaggaagcaagcttacagaagttcttcgtgattcatttgttggtaactctaggacggtgatgatctcttgcatttctccaaatgcaggttcatgtgaacacacattaaataccttgagatatgctgacaggtaataattcaaagcgtactttacagtctccaattcatgtacaggtttcagttacttaatgtccattaacttacaaaattactgaccaactaacagggttaaaagtctctcaaagggcagcaatacaagaaaagagcagcccactgggccaactataccttccagcaaggattcttcatctgccccttcatatcctatgcccatcgaaactgaggaaattgccaaccagattcaagagaagagacctgttgaaacttctaggaaggctgctgaaaatttcacctcgaactcttctatggaacctgacaggaatcctgttagtatgattccaagttattctaatagaggaaaagaagaaaatggttcatctggcttgaatgacagagaacgggttgatctgaattccagtcgaattagctacaacagtaaaccacagtctgttcagagttcagcaaatttacaagaagaggaaaaggttacaaaagtttctcctcctcggagaaaggcctatagggatgacaaacctgaaaggcagagcaactatgcgaagaaggatagtggacctgagacaagtaggcctgggtataaggtgcagcaggcaaagcagttgcaacagcaacaacggccgacatctgcttcagcttctcagaattcatcaaggcaatctgaaaaggaaagttcttgtgatgatgtggaaatagatgctattcttgaggtaaaggaataatctgcaagtactgttatgttataatcctgaatggagttatacatcaaattttcttttatatgttaggaagaggaggctctcatagcagcacacaggaaggaaatcgagaacactatggagattgtacgagaagtaagttattgatgtactgtgcttcctcagggtgaacggcatcatcatatatattgcacttgtagctccaatgttcttaactagaatctttccagacattgagaagtcccctcccctgttataacatgtgatggccagtaaaaacctactaagccgagctcaaagaatctaagcagccatgttggttacatctcaattcattaggcctaaaatatttatttaagcgctgtaggcaggctataactgctttcgaatctgagttgcatatcatgtaatattaacctgcttataagttacaacttgtgaagttagtagtgttgaattctttggtttgatctgaagttgaatgtagaactagttcagtcttgtgcacaacttgaatctaagtaggtgattcaagtgcattgcacacgatttctatctttgttgtgtacgtgtttcggcttatgaaatatggcatcccttgattatatcatgcatctgaaccaagtgcatctttacttttcaatttcaggagatgaaccttttggcagaagttgaccagccagggagccttattgacaactatgtaacacaactgagttttcttctgtcacgcaaggctgctggcttggtcagcctccaagcacgcctggcgcggtttcagcatcgcctcaaagagcaggagatactcagccgtaagaaatcttccagataaagcccccggtcatctctcggcgactttggccttttgccttgtcagagcaccgattggagctttgaccgccgtttcatgcgaagctcttcccctgtcgggctcctgtaacgttggatctaagcaaggagctaagcgaagatatagcgcagttgcttagagaggcgcctggttggtggtttcctttgggacgttttgtcaggtttggtcagcagtttgctaaaatagtccttccacagtggggctgcttgggcttgtgttgtttttttggcagatgcatggcttggcctcttttgccagtttttccattgtatgatgagacgtgtaactactgtgtttgcagatatggatgggttggtttccgatgtttgggagacaaatcctctcttcttttttttttatcaacatagagatattgctgctgtattctttactgattatttgcgttgagaaagaaaaagtttgtgtatgtcaaggactagaaaatatttaatattcaccccat</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0154700, RefSeq:Os05g0154700