Difference between revisions of "Os05g0154700"
(→Function) |
(→Expression) |
||
| Line 6: | Line 6: | ||
===Expression=== | ===Expression=== | ||
| − | + | This subsection of the ‘Protein attributes’ section indicates the type of evidence that supports the existence of the protein. Note that this subsection does not give information on the accuracy or correctness of the sequence(s) displayed. While it gives information on the existence of a protein, it may happen that the sequence slightly differs from genomic sequences, especially for sequences derived from gene model predictions. | |
| + | |||
| + | In UniProtKB there are 5 types of evidence for the existence of a protein: | ||
| + | 1. Evidence at protein level | ||
| + | 2. Evidence at transcript level | ||
| + | 3. Inferred from homology | ||
| + | 4. Predicted | ||
| + | 5. Uncertain | ||
| + | The value ‘Evidence at protein level’ indicates that there is clear experimental evidence for the existence of the protein. The criteria include partial or complete Edman sequencing, clear identification by mass spectrometry, X-ray or NMR structure, good quality protein-protein interaction or detection of the protein by antibodies. | ||
| + | |||
| + | The value ‘Evidence at transcript level’ indicates that the existence of a protein has not been strictly proven but that expression data (such as existence of cDNA(s), RT-PCR or Northern blots) indicate the existence of a transcript. | ||
| + | |||
| + | The value ‘Inferred by homology’ indicates that the existence of a protein is probable because clear orthologs exist in closely related species. | ||
| + | |||
| + | The value ‘Predicted’ is used for entries without evidence at protein, transcript, or homology levels. | ||
| + | |||
| + | The value ‘Uncertain’ indicates that the existence of the protein is unsure. | ||
| + | |||
| + | Only the highest or most reliable level of supporting evidence for the existence of a protein is displayed for each entry. For example, if the existence of a protein is supported by both the presence of ESTs and direct protein sequencing, the protein is assigned the value ‘Evidence at protein level’. | ||
| + | |||
| + | The ‘protein existence’ value is assigned automatically, based on the annotation elements present in the entry. The criteria used by this automatic procedure are listed in the document ‘Criteria used to assign the PE level of entries’. | ||
===Evolution=== | ===Evolution=== | ||
Revision as of 16:11, 5 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
The causal gene of a novel small and round seed mutant phenotype (srs3) in rice was identified by map-based cloning and named the SRS3 gene. The SRS3 gene was grouped as a member of the kinesin 13 subfamily. The SRS3 gene codes for a protein of 819 amino acids that contains a kinesin motor domain and a coiled-coil structure. Using scanning electron microscopy, we determined that the cell length of seeds in the longitudinal direction in srs3 is shorter than that in the wild type. The number of cells of seeds in the longitudinal direction in srs3 was not very different from that in the wild type. The result suggests that the small and round seed phenotype of srs3 is due to a reduction in cell length of seeds in the longitudinal direction. The SRS3 protein, which is found in the crude microsomal fraction, is highly expressed in developing organs.
Expression
This subsection of the ‘Protein attributes’ section indicates the type of evidence that supports the existence of the protein. Note that this subsection does not give information on the accuracy or correctness of the sequence(s) displayed. While it gives information on the existence of a protein, it may happen that the sequence slightly differs from genomic sequences, especially for sequences derived from gene model predictions.
In UniProtKB there are 5 types of evidence for the existence of a protein: 1. Evidence at protein level 2. Evidence at transcript level 3. Inferred from homology 4. Predicted 5. Uncertain The value ‘Evidence at protein level’ indicates that there is clear experimental evidence for the existence of the protein. The criteria include partial or complete Edman sequencing, clear identification by mass spectrometry, X-ray or NMR structure, good quality protein-protein interaction or detection of the protein by antibodies.
The value ‘Evidence at transcript level’ indicates that the existence of a protein has not been strictly proven but that expression data (such as existence of cDNA(s), RT-PCR or Northern blots) indicate the existence of a transcript.
The value ‘Inferred by homology’ indicates that the existence of a protein is probable because clear orthologs exist in closely related species.
The value ‘Predicted’ is used for entries without evidence at protein, transcript, or homology levels.
The value ‘Uncertain’ indicates that the existence of the protein is unsure.
Only the highest or most reliable level of supporting evidence for the existence of a protein is displayed for each entry. For example, if the existence of a protein is supported by both the presence of ESTs and direct protein sequencing, the protein is assigned the value ‘Evidence at protein level’.
The ‘protein existence’ value is assigned automatically, based on the annotation elements present in the entry. The criteria used by this automatic procedure are listed in the document ‘Criteria used to assign the PE level of entries’.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os05g0154700 |
|---|---|
| Description |
Similar to Kinesin heavy chain (Fragment) |
| Version |
NM_001061219.1 GI:115462168 GeneID:4337845 |
| Length |
2667 bp |
| Definition |
Oryza sativa Japonica Group Os05g0154700, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 5:3185563..3188229 |
| Sequence Coding Region |
3185564..3185877,3185953..3186171,3186268..3186886,3186965..3187030,3187545..3187727 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008398:3185563..3188229 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008398:3185563..3188229 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>ggcaagaaacaagtttgcattgttggtctgcaagaatttgaggtttctgatgttcagattgtcaaggaatatattgagagaggaaatgcagcccggagtacagggtcaacaggggccaatgaagaatcatcaaggtcacatgctattctgcagctggctatcaagaaacatatcatagtaactgataccaggcgacaaagagatcgagatgctaatgaatctaaaaacacaaaggctgtgggaaaaatttcatttattgatcttgctggaagcgagcgtggagccgatacaacagacaatgataggcagacgagaattgaaggagctgagataaacaagagcctgctcgctctgaaggaatgcattcgggcccttgataacgatcagatacacattcctttcagaggaagcaagcttacagaagttcttcgtgattcatttgttggtaactctaggacggtgatgatctcttgcatttctccaaatgcaggttcatgtgaacacacattaaataccttgagatatgctgacagggttaaaagtctctcaaagggcagcaatacaagaaaagagcagcccactgggccaactataccttccagcaaggattcttcatctgccccttcatatcctatgcccatcgaaactgaggaaattgccaaccagattcaagagaagagacctgttgaaacttctaggaaggctgctgaaaatttcacctcgaactcttctatggaacctgacaggaatcctgttagtatgattccaagttattctaatagaggaaaagaagaaaatggttcatctggcttgaatgacagagaacgggttgatctgaattccagtcgaattagctacaacagtaaaccacagtctgttcagagttcagcaaatttacaagaagaggaaaaggttacaaaagtttctcctcctcggagaaaggcctatagggatgacaaacctgaaaggcagagcaactatgcgaagaaggatagtggacctgagacaagtaggcctgggtataaggtgcagcaggcaaagcagttgcaacagcaacaacggccgacatctgcttcagcttctcagaattcatcaaggcaatctgaaaaggaaagttcttgtgatgatgtggaaatagatgctattcttgaggaagaggaggctctcatagcagcacacaggaaggaaatcgagaacactatggagattgtacgagaagagatgaaccttttggcagaagttgaccagccagggagccttattgacaactatgtaacacaactgagttttcttctgtcacgcaaggctgctggcttggtcagcctccaagcacgcctggcgcggtttcagcatcgcctcaaagagcaggagatactcagccgtaagaaatcttccagataa</cdnaseq> |
| Protein Sequence |
<aaseq>GKKQVCIVGLQEFEVSDVQIVKEYIERGNAARSTGSTGANEESS RSHAILQLAIKKHIIVTDTRRQRDRDANESKNTKAVGKISFIDLAGSERGADTTDNDR QTRIEGAEINKSLLALKECIRALDNDQIHIPFRGSKLTEVLRDSFVGNSRTVMISCIS PNAGSCEHTLNTLRYADRVKSLSKGSNTRKEQPTGPTIPSSKDSSSAPSYPMPIETEE IANQIQEKRPVETSRKAAENFTSNSSMEPDRNPVSMIPSYSNRGKEENGSSGLNDRER VDLNSSRISYNSKPQSVQSSANLQEEEKVTKVSPPRRKAYRDDKPERQSNYAKKDSGP ETSRPGYKVQQAKQLQQQQRPTSASASQNSSRQSEKESSCDDVEIDAILEEEEALIAA HRKEIENTMEIVREEMNLLAEVDQPGSLIDNYVTQLSFLLSRKAAGLVSLQARLARFQ HRLKEQEILSRKKSSR</aaseq> |
| Gene Sequence |
<dnaseqindica>2..315#391..609#706..1324#1403..1468#1983..2165#tggcaagaaacaagtttgcattgttggtctgcaagaatttgaggtttctgatgttcagattgtcaaggaatatattgagagaggaaatgcagcccggagtacagggtcaacaggggccaatgaagaatcatcaaggtcacatgctattctgcagctggctatcaagaaacatatcatagtaactgataccaggcgacaaagagatcgagatgctaatgaatctaaaaacacaaaggctgtgggaaaaatttcatttattgatcttgctggaagcgagcgtggagccgatacaacagacaatgataggcagacgaggtgataattttttatcttacttttccttgttgcctgtattttctaactattgacctgcaacttttgttttctcagaattgaaggagctgagataaacaagagcctgctcgctctgaaggaatgcattcgggcccttgataacgatcagatacacattcctttcagaggaagcaagcttacagaagttcttcgtgattcatttgttggtaactctaggacggtgatgatctcttgcatttctccaaatgcaggttcatgtgaacacacattaaataccttgagatatgctgacaggtaataattcaaagcgtactttacagtctccaattcatgtacaggtttcagttacttaatgtccattaacttacaaaattactgaccaactaacagggttaaaagtctctcaaagggcagcaatacaagaaaagagcagcccactgggccaactataccttccagcaaggattcttcatctgccccttcatatcctatgcccatcgaaactgaggaaattgccaaccagattcaagagaagagacctgttgaaacttctaggaaggctgctgaaaatttcacctcgaactcttctatggaacctgacaggaatcctgttagtatgattccaagttattctaatagaggaaaagaagaaaatggttcatctggcttgaatgacagagaacgggttgatctgaattccagtcgaattagctacaacagtaaaccacagtctgttcagagttcagcaaatttacaagaagaggaaaaggttacaaaagtttctcctcctcggagaaaggcctatagggatgacaaacctgaaaggcagagcaactatgcgaagaaggatagtggacctgagacaagtaggcctgggtataaggtgcagcaggcaaagcagttgcaacagcaacaacggccgacatctgcttcagcttctcagaattcatcaaggcaatctgaaaaggaaagttcttgtgatgatgtggaaatagatgctattcttgaggtaaaggaataatctgcaagtactgttatgttataatcctgaatggagttatacatcaaattttcttttatatgttaggaagaggaggctctcatagcagcacacaggaaggaaatcgagaacactatggagattgtacgagaagtaagttattgatgtactgtgcttcctcagggtgaacggcatcatcatatatattgcacttgtagctccaatgttcttaactagaatctttccagacattgagaagtcccctcccctgttataacatgtgatggccagtaaaaacctactaagccgagctcaaagaatctaagcagccatgttggttacatctcaattcattaggcctaaaatatttatttaagcgctgtaggcaggctataactgctttcgaatctgagttgcatatcatgtaatattaacctgcttataagttacaacttgtgaagttagtagtgttgaattctttggtttgatctgaagttgaatgtagaactagttcagtcttgtgcacaacttgaatctaagtaggtgattcaagtgcattgcacacgatttctatctttgttgtgtacgtgtttcggcttatgaaatatggcatcccttgattatatcatgcatctgaaccaagtgcatctttacttttcaatttcaggagatgaaccttttggcagaagttgaccagccagggagccttattgacaactatgtaacacaactgagttttcttctgtcacgcaaggctgctggcttggtcagcctccaagcacgcctggcgcggtttcagcatcgcctcaaagagcaggagatactcagccgtaagaaatcttccagataaagcccccggtcatctctcggcgactttggccttttgccttgtcagagcaccgattggagctttgaccgccgtttcatgcgaagctcttcccctgtcgggctcctgtaacgttggatctaagcaaggagctaagcgaagatatagcgcagttgcttagagaggcgcctggttggtggtttcctttgggacgttttgtcaggtttggtcagcagtttgctaaaatagtccttccacagtggggctgcttgggcttgtgttgtttttttggcagatgcatggcttggcctcttttgccagtttttccattgtatgatgagacgtgtaactactgtgtttgcagatatggatgggttggtttccgatgtttgggagacaaatcctctcttcttttttttttatcaacatagagatattgctgctgtattctttactgattatttgcgttgagaaagaaaaagtttgtgtatgtcaaggactagaaaatatttaatattcaccccat</dnaseqindica> |
| External Link(s) |