Difference between revisions of "Os05g0343400"

From RiceWiki
Jump to: navigation, search
(References)
(References)
Line 46: Line 46:
 
==References==
 
==References==
  
1. Chujo, T., et al. (2007). "Involvement of the elicitor-induced gene OsWRKY53 in the expression of defense-related genes in rice." Biochimica et Biophysica Acta (BBA) - Gene Structure and Expression 1769(7–8): 497-505.
+
<ref name="ref1"> Chujo, T., et al. (2007). "Involvement of the elicitor-induced gene OsWRKY53 in the expression of defense-related genes in rice." Biochimica et Biophysica Acta (BBA) - Gene Structure and Expression 1769(7–8): 497-505.
 
2. Chujo, T., et al. (2009). "Promoter analysis of the elicitor-induced WRKY gene OsWRKY53, which is involved in defense responses in rice." Biosci Biotechnol Biochem 73(8): 1901-1904.
 
2. Chujo, T., et al. (2009). "Promoter analysis of the elicitor-induced WRKY gene OsWRKY53, which is involved in defense responses in rice." Biosci Biotechnol Biochem 73(8): 1901-1904.
 
3. Xie, Z., et al. (2005). "Annotations and Functional Analyses of the Rice WRKY Gene Superfamily Reveal Positive and Negative Regulators of Abscisic Acid Signaling in Aleurone Cells." Plant Physiology 137(1): 176-189.
 
3. Xie, Z., et al. (2005). "Annotations and Functional Analyses of the Rice WRKY Gene Superfamily Reveal Positive and Negative Regulators of Abscisic Acid Signaling in Aleurone Cells." Plant Physiology 137(1): 176-189.

Revision as of 02:42, 6 June 2014

Please input one-sentence summary here.

Annotated Information

   OsWRKY53 is a member of WRKY Gene Family.

Function

   OsWRKY53 is a common transcription factor in the signal transduction pathways triggered by both chitin oligosaccharide and fungal cerebroside elicitors. OsWRKY53 localizes to the nucleus and activates the expression of defense-related genes. Involving in basal defense responses to pathogen infection in rice. 

Expression

   WRKY proteins form a large family of plant-specific transcription factors that specifically bind to the W-box elements  (T)TGAC(C/T) and appear to play a regulatory role in a variety of stress responses.WRKY proteins have been investigated extensively for their possible involvement in defense responses against attacks by pathogens, mainly in dicotyledonous plants such as Arabidopsis and tobacco . The rice genome is predicted to contain over 100 Oryza sativa L.WRKY (OsWRKY)genes. 
  1.1 cDNA cloning and expression analysis of OsWRKY53
  A full-length cDNA of OsWRKY53 (AK121190; named by Xie et al.) was isolated from elicited suspension-cultured rice cells by RT-PCR using primers that were designed based on information from a rice genome database. The nucleotide sequence of the OsWRKY53 cDNA reported in this paper will appear in the DNA Data Bank of Japan (DDBJ) nucleotide sequence database under the accession number AB190436.
  All known WRKY proteins contain up to two WRKY domains and are classified based on both the number of WRKY domains and the features of their zinc finger-like motifs. OsWRKY53 belongs to group I, which is characterized by two WRKY domains that contain the Cys2His2 zinc finger-like motif. 
  To investigate the involvement of OsWRKY53 in defense responses to pathogen infection, examining its expression using Northern hybridization. The elicitor-induced changes in the steady-state levels of the OsWRKY53 mRNA in suspensioncultured rice cells are shown in Fig. 1a. The mRNA level peaked

0.5 h after the addition of each elicitor (chitin oligosaccharide and fungal cerebroside elicitors), and decreased gradually thereafter. analyzing the expression pattern of OsWRKY53 in rice plants (cv. Nipponbare) inoculated with the fungal pathogen M. grisea race 007, which is compatible with cv. Nipponbare.

  Northern hybridization revealed a significant increase in the level of OsWRKY53 mRNA at 6 h after inoculation, after which it decreased gradually (Fig. 1b). These results strongly suggest that OsWRKY53 is involved in the basal defense responses of rice against pathogen infection.
  1.2 Comparison of the OsWRKY53 sequence with other
  homologous WRKY proteins and subcellular localization The OsWRKY53 amino acid sequence was compared with those of other known group-IWRKYproteins involved in defense responses (Fig. 2). OsWRKY53 showed similarity to PcWRKY1 from parsley (38% identity) [31] and AtWRKY33 from Arabidopsis

(43% identity). A putative nuclear localization signal was identified in the OsWRKY53 amino acid sequence, as in PcWRKY1 and AtWRKY33, suggesting that OsWRKY53 localizes to the nucleus.

  To investigate the subcellular localization of the OsWRKY53 protein, OsWRKY53 was fused in-frame to the sGFP reporter gene and subcloned into an expression vector under the control of the CaMV 35S promoter. This construct and a similar construct encoding sGFP alone were introduced into onion epidermal cells via particle bombardment. Onion cells expressing sGFP alone fluoresced throughout the cell. In contrast, cells transformed with a plasmid expressing the sGFP:OsWRKY53 fusion protein fluoresced mainly in the nuclei.
  1.3 Binding of OsWRKY53 to conserved W-box motifs
  The DNA-binding activity of OsWRKY53 was investigated in vitro by a GMSA using partially purified Trx-OsWRKY53(Fig. 4). The DNA probe used was the double-stranded synthetic oligonucleotide BS65, which has been reported to represent a binding site of WRKY-family proteins in Arabidopsis and tobacco. When incubated with the recombinant OsWRKY53, BS65 produced retarded bands; in contrast, no retardation of the probe was observed with Trx alone. To verify the binding specificity of OsWRKY53 to the DNA probe, a parallel binding assay was performed with competitor DNA. A 250-fold molar excess of the cold target DNA was sufficient to compete with, and eliminate, the retardation of the labeled probe.
  To investigate whether the TGAC core sequence is essential for the sequence-specific binding activity, testing a mutant probe in which the two TGAC sequences were changed to CCTA. This mutant probe, mBS65, was not recognized by OsWRKY53,indicating that the probe retardation was due to the specific

binding activity of OsWRKY53 to the W-box elements.

  1.4 Transactivation of gene transcription by OsWRKY53
  To investigate the function of OsWRKY53, we constructed an effector plasmid that contains the CaMV 35S promoter driving a gene that encodes a fusion protein of the DNA-binding domain of the yeast transcriptional activator GAL4 (GAL4 DB) and the full-length OsWRKY53. This plasmid, or a control plasmid encoding GAL4 DB alone, were cotransfected by particle bombardment into rice cells along with the reporter plasmid GAL4-LUC, which contains four copies of a GAL4 binding site fused to LUC. Compared with rice cells expressing GAL4 DB alone, those expressing the GAL4-OsWRKY53 fusion protein showed approximately 25-fold greater luciferase reporter activity.
  
  1.5 Activation of defense-related genes in OsWRKY53-overexpressing transgenic rice 
  attempting to comprehensively identify genes upregulated in OsWRKY53-overexpressing transgenic rice cells using the Agilent Rice Oligo Microarray, which contains more than 21,000 rice genes. Total RNA samples were prepared from three independent lines of OsWRKY53-overexpressing transgenic rice cells (lines A, C, and E in Fig. 6) and used for microarray analysis. A total of 221 genes were upregulated in the OsWRKY53-overexpressing transgenic rice cells. One third of the upregulated genes are of unknown function, and the other two thirds include genes likely to be related to metabolism,regulation of gene expression, defense, transport, proteolysis,and signal transduction. Another microarray analysis revealed that 102 of the 221 genes were upregulated by chitin oligosaccharide elicitor treatment (data not shown).  Table 1 shows the nine most-upregulated defenserelated genes in the OsWRKY53-overexpressing transgenic rice cells. Of these nine genes, six (PBZ1 (AK071613), a PR-14 gene encoding a putative lipid transfer protein (AK058896), Chitinase1 (AK073267), PR-5 (AK111104), Chitinase 2 (AK102505), and Peroxidase (AK102307)) are chitin oligosaccharide-inducible.

The upregulation of these six genes in five independent OsWRKY53-overexpressing transgenic rice lines was demonstrated using real time RT-PCR


Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

<ref name="ref1"> Chujo, T., et al. (2007). "Involvement of the elicitor-induced gene OsWRKY53 in the expression of defense-related genes in rice." Biochimica et Biophysica Acta (BBA) - Gene Structure and Expression 1769(7–8): 497-505. 2. Chujo, T., et al. (2009). "Promoter analysis of the elicitor-induced WRKY gene OsWRKY53, which is involved in defense responses in rice." Biosci Biotechnol Biochem 73(8): 1901-1904. 3. Xie, Z., et al. (2005). "Annotations and Functional Analyses of the Rice WRKY Gene Superfamily Reveal Positive and Negative Regulators of Abscisic Acid Signaling in Aleurone Cells." Plant Physiology 137(1): 176-189.

4. Ross, C. A., et al. (2007). "The WRKY Gene Family in Rice (Oryza sativa)." Journal of Integrative Plant Biology 49(6): 827-842. 5. Ramamoorthy, R., et al. (2008). "A Comprehensive Transcriptional Profiling of the WRKY Gene Family in Rice Under Various Abiotic and Phytohormone Treatments." Plant and Cell Physiology 49(6): 865-879.

Structured Information

Gene Name

Os05g0343400

Description

WRKY transcription factor 53 (Transcription factor WRKY12)

Version

NM_001061787.1 GI:115463304 GeneID:4338474

Length

2368 bp

Definition

Oryza sativa Japonica Group Os05g0343400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:16128079..16130446

Sequence Coding Region

16128193..16128504,16128618..16128782,16128881..16129341,16129441..16129617,16129715..16130063

Expression

GEO Profiles:Os05g0343400

Genome Context

<gbrowseImage1> name=NC_008398:16128079..16130446 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:16128079..16130446 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgtcctcgacgggggggttggaccacgggttcacgttcacgccgccgccgttcatcacgtcgttcaccgagctgctgtcggggggcggtggggacctgctcggcgccggcggtgaggagcgctcgccgagggggttctccagaggcggagcgagggtgggcggcggggtgcccaagttcaagtccgcgcagccgccgagcctgccgctctcgccgccgccggtgtcgccgtcgtcctacttcgccatcccgccggggctcagccccaccgagctgctcgactcccccgtcctcctcagctcctcccatatcttggcgtccccgaccaccggtgcaatcccggctcagaggtacgactggaaggccagcgccgatctcatcgcttctcagcaagatgacagccgcggcgacttctccttccacaccaactccgacgccatggccgcgcaaccggcctctttcccttccttcaaggagcaagagcagcaagtggtcgagtcgagcaagaacggcgccgccgccgcgtcgagcaacaagagcggcggcggcgggaacaacaagctggaggacgggtacaactggaggaagtacgggcagaagcaggtgaaggggagcgagaacccgaggagctactacaagtgcacctacaacggctgctccatgaagaagaaggtggagcgctcgctcgccgacggccgcatcacccagatcgtctacaagggcgcacacaaccaccccaagccgctctccacccgccgcaacgcctcctcctgcgccaccgccgccgcctgcgccgacgacctcgcggcgcccggcgcgggcgcggaccagtactccgccgcgacgcccgagaactcctccgtcacgttcggcgacgacgaggccgacaacgcatcgcaccgcagcgagggcgacgagcccgaagccaagcgctggaaggaggatgctgacaacgagggcagctccggcggcatgggcggcggcgccggcggcaagccggtgcgcgagccgaggcttgtggtgcagacgctgagcgacatcgacatcctcgacgacggcttccggtggaggaagtacggccagaaggtcgtcaagggcaaccccaacccaaggagctactacaagtgcacgacggtgggctgcccggtgcggaagcacgtggagcgggcgtcgcacgacacgcgcgccgtgatcaccacctacgagggcaagcacaaccacgacgtcccggtcggccgcggcggcggcggcggacgcgccccggcgccggcgccgccgacgtcgggggcgatccggccgtcggccgtcgccgccgcccagcaggggccctacaccctcgagatgctccccaaccccgccggcctctacggcggctacggcgccggcgccggcggcgccgcgttcccgcgcaccaaggacgagcggcgggacgacctgttcgtcgagtcgctcctctgctag</cdnaseq>

Protein Sequence

<aaseq>MASSTGGLDHGFTFTPPPFITSFTELLSGGGGDLLGAGGEERSP RGFSRGGARVGGGVPKFKSAQPPSLPLSPPPVSPSSYFAIPPGLSPTELLDSPVLLSS SHILASPTTGAIPAQRYDWKASADLIASQQDDSRGDFSFHTNSDAMAAQPASFPSFKE QEQQVVESSKNGAAAASSNKSGGGGNNKLEDGYNWRKYGQKQVKGSENPRSYYKCTYN GCSMKKKVERSLADGRITQIVYKGAHNHPKPLSTRRNASSCATAAACADDLAAPGAGA DQYSAATPENSSVTFGDDEADNASHRSEGDEPEAKRWKEDADNEGSSGGMGGGAGGKP VREPRLVVQTLSDIDILDDGFRWRKYGQKVVKGNPNPRSYYKCTTVGCPVRKHVERAS HDTRAVITTYEGKHNHDVPVGRGGGGGRAPAPAPPTSGAIRPSAVAAAQQGPYTLEML PNPAGLYGGYGAGAGGAAFPRTKDERRDDLFVESLLC</aaseq>

Gene Sequence

<dnaseqindica>115..426#540..704#803..1263#1363..1539#1637..1985#actcccgtctcgtcgtctcgttctcgtctccgatcactctcctcctcatcttcgtcacggtctcctcgcttcgctagctcgcttgcttgctggctgagctgtggtacgctcgccatggcgtcctcgacgggggggttggaccacgggttcacgttcacgccgccgccgttcatcacgtcgttcaccgagctgctgtcggggggcggtggggacctgctcggcgccggcggtgaggagcgctcgccgagggggttctccagaggcggagcgagggtgggcggcggggtgcccaagttcaagtccgcgcagccgccgagcctgccgctctcgccgccgccggtgtcgccgtcgtcctacttcgccatcccgccggggctcagccccaccgagctgctcgactcccccgtcctcctcagctcctcccatgtgcgttccgcgtgacacaccttcatcttcttcttctacctttagtgcgcaattgctgtgtagtgtggtgctgatgatgatccatggcgtttgtgcgtgtttgtgcttttcagatcttggcgtccccgaccaccggtgcaatcccggctcagaggtacgactggaaggccagcgccgatctcatcgcttctcagcaagatgacagccgcggcgacttctccttccacaccaactccgacgccatggccgcgcaaccggcctctttcccttccttcaaggtacgtacaaatgcttcagctcatctagctcaacccaagctgaataaactgttgacagtctagctcaccttggttcatgtacgcttgtgctggagcaggagcaagagcagcaagtggtcgagtcgagcaagaacggcgccgccgccgcgtcgagcaacaagagcggcggcggcgggaacaacaagctggaggacgggtacaactggaggaagtacgggcagaagcaggtgaaggggagcgagaacccgaggagctactacaagtgcacctacaacggctgctccatgaagaagaaggtggagcgctcgctcgccgacggccgcatcacccagatcgtctacaagggcgcacacaaccaccccaagccgctctccacccgccgcaacgcctcctcctgcgccaccgccgccgcctgcgccgacgacctcgcggcgcccggcgcgggcgcggaccagtactccgccgcgacgcccgagaactcctccgtcacgttcggcgacgacgaggccgacaacgcatcgcaccgcagcgagggcgacgagcccgaagccaagcgctggtaagcctcacatcatcactcaaatcagcaatcgaagcgtaatatctccatgcgtgtgcgtgtgttcttcttgggtctcatggatgtcatggttttcaggaaggaggatgctgacaacgagggcagctccggcggcatgggcggcggcgccggcggcaagccggtgcgcgagccgaggcttgtggtgcagacgctgagcgacatcgacatcctcgacgacggcttccggtggaggaagtacggccagaaggtcgtcaagggcaaccccaacccaaggtaatcaatcaatcaagctgatcaaaatccgtcgattagtcgattaatcatatctgttcttgcgtctctaataatcaaatctgttcttgaatcgcaggagctactacaagtgcacgacggtgggctgcccggtgcggaagcacgtggagcgggcgtcgcacgacacgcgcgccgtgatcaccacctacgagggcaagcacaaccacgacgtcccggtcggccgcggcggcggcggcggacgcgccccggcgccggcgccgccgacgtcgggggcgatccggccgtcggccgtcgccgccgcccagcaggggccctacaccctcgagatgctccccaaccccgccggcctctacggcggctacggcgccggcgccggcggcgccgcgttcccgcgcaccaaggacgagcggcgggacgacctgttcgtcgagtcgctcctctgctagtcgagccgagccgagccgagctgagctgggccccacatccccctgctcgccacgtggcgtattttcgcctcgccgtatacgtacggccgtatagcgtacgtatacacgctcgcacgccctgcccaacacggcaatacacacatacatactctcgtacacacgtagtagcatacatatacagtatagtaggtggtagtggtagctagctagggagtgagatccaatttgttgattcgttgcaggccactgccacgtgggccacaccggaaacagtacacgcgtatacaccacacttgggatacgcgtacgtacgcacatgtacacgtagttttgtgcctttgtaactgctgagagacaggtcaaataagactgatgaatttttc</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0343400, RefSeq:Os05g0343400