Difference between revisions of "Os03g0188400"

From RiceWiki
Jump to: navigation, search
(Expression)
(Annotated Information)
Line 1: Line 1:
 
Please input one-sentence summary here.
 
Please input one-sentence summary here.
  
==Annotated Information==
+
==Function==
 
Previous studies have contributed to the development of over 6000 DNA markers3-5 (http://rgp.dna.affrc.go.jp/; http://www.gramene.org) that provide genome coverage of approximately one marker every 0.25 cM, or every 75-100 kb. Most are expressed sequence tags (ESTs) that are widely used as the basis for physical map construction, sequence assembly and comparative genome analysis, but polymorphism detection within the cultivated rice gene pool is inefficient.
 
Previous studies have contributed to the development of over 6000 DNA markers3-5 (http://rgp.dna.affrc.go.jp/; http://www.gramene.org) that provide genome coverage of approximately one marker every 0.25 cM, or every 75-100 kb. Most are expressed sequence tags (ESTs) that are widely used as the basis for physical map construction, sequence assembly and comparative genome analysis, but polymorphism detection within the cultivated rice gene pool is inefficient.
  
Line 10: Line 10:
 
5. Os03g0188400 - Lipopolysaccharide and chitin oligosaccharide effect on rice cells
 
5. Os03g0188400 - Lipopolysaccharide and chitin oligosaccharide effect on rice cells
 
6. Os03g0188400 - Benzothiadiazole effect on Oryza sativa leaves
 
6. Os03g0188400 - Benzothiadiazole effect on Oryza sativa leaves
 +
 
== Expression ==
 
== Expression ==
 
     It is necessary to reexamine the predicted genes with use of experimental data and systematically analyze the alternatively spliced transcripts in the rice genome.
 
     It is necessary to reexamine the predicted genes with use of experimental data and systematically analyze the alternatively spliced transcripts in the rice genome.

Revision as of 05:01, 6 June 2014

Please input one-sentence summary here.

Function

Previous studies have contributed to the development of over 6000 DNA markers3-5 (http://rgp.dna.affrc.go.jp/; http://www.gramene.org) that provide genome coverage of approximately one marker every 0.25 cM, or every 75-100 kb. Most are expressed sequence tags (ESTs) that are widely used as the basis for physical map construction, sequence assembly and comparative genome analysis, but polymorphism detection within the cultivated rice gene pool is inefficient.

1. Os03g0188400 - Cytokinin-inducible type-A response regulator OsRR6 overexpression effect on rice leaves 2. Os03g0188400 - Abscisic acid and gibberellin effect on calluses (dye-swap) 3. Os03g0188400 - Abscisic acid and gibberellin effect on calluses 4. Os03g0188400 - Silent Information Regulator 2-related gene OsSRT1 knockdown effect on rice leaves 5. Os03g0188400 - Lipopolysaccharide and chitin oligosaccharide effect on rice cells 6. Os03g0188400 - Benzothiadiazole effect on Oryza sativa leaves

Expression

   It is necessary to reexamine the predicted genes with use of experimental data and systematically analyze the alternatively spliced transcripts in the rice genome.
   ESTs are regarded as direct evidence of gene expression. With suitable algorithms and well-curated ESTs, the inherent errors in EST information can be effectively reduced in gene/isoform annotations.

EST sequences: 1.Accession: D40346.1 Description:RICS2264A Rice shoot Oryza sativa (japonica cultivar-group) cDNA, mRNA sequence Library ID:193 End:569497

         Tissue:stem

2.Accession:BF145188.1 Description:EI35K24 Normalized rice cDNA library Oryza sativa cDNA clone EI35K24 similar to Pathogen induced defense- responsive sequence, mRNA sequence

         Clone:EI35K24

Library ID:6983 GI:40385992

         Tissue:mixed

3.Accession:CF993041.1 Description:22185rsicee_7682.y1 Oryza sativa cv. LYP9 tillering whole plant cDNA library Oryza sativa (indica cultivar-group) cDNA 5', mRNA sequence Library ID:14617 GI:58594733

        End:5'		
        Tissue:whole plant

4.Accession:CK011973.1 Description:24659rsicef_0866.y1 Oryza sativa cv. PA64s panicle sterile cDNA library Oryza sativa (indica cultivar-group) cDNA 5', mRNA sequence Library ID:14618 GI:58601445

        End:5'		
        Tissue:panicle

5.Accession:BX901684 Description:BX901684 Oryza sativa library (Han B) Oryza sativa cDNA clone p726b05p5, mRNA sequence Library ID:15105

         Clone:p726b05p5	

GI:40491772

        Tissue:unspecified_tissue







Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os03g0188400

Description

Basic helix-loop-helix dimerisation region bHLH domain containing protein

Version

NM_001055752.1 GI:115451232 GeneID:4331887

Length

1580 bp

Definition

Oryza sativa Japonica Group Os03g0188400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:4607271..4608850

Sequence Coding Region

4607376..4607801,4607897..4608355,4608529..4608633

Expression

GEO Profiles:Os03g0188400

Genome Context

<gbrowseImage1> name=NC_008396:4607271..4608850 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:4607271..4608850 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgttagaggccgtggtgtttccgcagggccatttcggctacgggtgcggaagggactcgccggcgtacgggatgccgtggtgcgacgtcctggctgctgccggcggcggcggcggcttcggtgagttttacggagtggacgagtgggatgaccagctgcaggtcgcctccgtggatgagtgggaggtggcatccaaggataactcggatgcttccacggagggcaaggcggcggcggcggagcgggcggagccggtggccgccgggaggaggaaacggaggcggacgaaggtcgtcaagaacaaggaggagatcgagtgccagcggatgacccacattgccgtcgagcgcaaccgccgccgccagatgaacgagtacctcgccgtgctccgctccctcatgccggcgtcctactcgcagaggggtgatcaagcatcgatcgtcggaggagcaatcaactacgtgaaggagctggagcagctactgcagtcgctggaagtccaaaagagcctcaagaaccgcagcggcgccatggacgccgccggcgattcccctttcgccggcttcttcagcttcccacagtactccacgtcgcctcgcactggctgcagcgccgccgccagcgccgggagctccggcagtgcgagcagcgtcgtcatggacgacacggcgggctccgcggagagcggccggcagtcggcggccatcgccgacatcgaggtgaccatggtggaagggcacgcgagcctcaaggtgctcgcgcggcggcgaccgaagcagctgctgaagctggtcgtcgggctgcagcagctgcgcatcccgccgctgcatctcaacgtgaccaccgtcgacgccatggtcctctactccttcagcctcaaggtggaggatgattccaagctgggctctgtggaagacattgccaccgctgtgcatcagatcctgggcagcattcagcagcaggaggccgtcctctccatcagctga</cdnaseq>

Protein Sequence

<aaseq>MALEAVVFPQGHFGYGCGRDSPAYGMPWCDVLAAAGGGGGFGEF YGVDEWDDQLQVASVDEWEVASKDNSDASTEGKAAAAERAEPVAAGRRKRRRTKVVKN KEEIECQRMTHIAVERNRRRQMNEYLAVLRSLMPASYSQRGDQASIVGGAINYVKELE QLLQSLEVQKSLKNRSGAMDAAGDSPFAGFFSFPQYSTSPRTGCSAAASAGSSGSASS VVMDDTAGSAESGRQSAAIADIEVTMVEGHASLKVLARRRPKQLLKLVVGLQQLRIPP LHLNVTTVDAMVLYSFSLKVEDDSKLGSVEDIATAVHQILGSIQQQEAVLSIS</aaseq>

Gene Sequence

<dnaseqindica>106..531#627..1085#1259..1363#aactcactctttaattcgcctccccctgaatcgtgtgcgtatcgtatcgtggcgtcgtcagttcgcgaaaaaaaacgcccgttcgttttgccgggtgcgtgcaggatggcgttagaggccgtggtgtttccgcagggccatttcggctacgggtgcggaagggactcgccggcgtacgggatgccgtggtgcgacgtcctggctgctgccggcggcggcggcggcttcggtgagttttacggagtggacgagtgggatgaccagctgcaggtcgcctccgtggatgagtgggaggtggcatccaaggataactcggatgcttccacggagggcaaggcggcggcggcggagcgggcggagccggtggccgccgggaggaggaaacggaggcggacgaaggtcgtcaagaacaaggaggagatcgagtgccagcggatgacccacattgccgtcgagcgcaaccgccgccgccagatgaacgagtacctcgccgtgctccgctccctcatgccggcgtcctactcgcagagggtacaacactaactacgcatgcttcaattaatcgcttttacgcatactgttatgattcgttaatcatcattaaatcgaatccattttctgctcagggtgatcaagcatcgatcgtcggaggagcaatcaactacgtgaaggagctggagcagctactgcagtcgctggaagtccaaaagagcctcaagaaccgcagcggcgccatggacgccgccggcgattcccctttcgccggcttcttcagcttcccacagtactccacgtcgcctcgcactggctgcagcgccgccgccagcgccgggagctccggcagtgcgagcagcgtcgtcatggacgacacggcgggctccgcggagagcggccggcagtcggcggccatcgccgacatcgaggtgaccatggtggaagggcacgcgagcctcaaggtgctcgcgcggcggcgaccgaagcagctgctgaagctggtcgtcgggctgcagcagctgcgcatcccgccgctgcatctcaacgtgaccaccgtcgacgccatggtcctctactccttcagcctcaaggtaaaaaccaatcgacaatttgcacctattttactaccacgactgcatgcttagttagtttaggctagcagcacagacaaattaagcgattggaacgtcgcgggtgagcgaagattcgctcccatttttctacaacgccgatgataatgtcatcgctttcgtttggatgttaggtggaggatgattccaagctgggctctgtggaagacattgccaccgctgtgcatcagatcctgggcagcattcagcagcaggaggccgtcctctccatcagctgacgccgcgatcgatggagacgacaaccgagacggccgccatgtgaagcctctgcctcgtccgtcctggaaatggaaccatggcgcctcgatcgatagcttgttagcttgtaatgtgtgaatgtgattgtaccctagccaacagagtgctgcatgcatgcagtatctccggcgaccttaatgagaaatctataccaacattttgagctcttgtaaacgt</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0188400, RefSeq:Os03g0188400