Difference between revisions of "Os02g57310"

From RiceWiki
Jump to: navigation, search
(Expression)
 
(15 intermediate revisions by the same user not shown)
Line 1: Line 1:
 
Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).
 
Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).
  
==Annotated Information==
+
=='''Annotated Information'''==
 
=== Gene structure===
 
=== Gene structure===
 
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic
 
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic
Line 7: Line 7:
 
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.<br>
 
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.<br>
 
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus
 
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus
positions indicating that they are likely to be buried in the hydrophobic core of the protein.  
+
positions indicating that they are likely to be buried in the hydrophobic core of the protein.
 +
 
 +
[[File:Figure1 gene struture.png|down| ]]
  
 
===Function===
 
===Function===
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.<br>
+
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.<br>  
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.<br>  
+
 
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).<br>
+
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from
 
 
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.
 
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.
  
 
===Expression===
 
===Expression===
 +
[[File:Figure2 expression.jpg|right|thumb|500px|]]
 
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.<br>
 
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.<br>
 +
 
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.<br>
 
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.<br>
 +
 
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.<br>
 
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.<br>
  
==References==
+
=='''References'''==
 
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.<br>
 
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.<br>
 
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.<br>
 
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.<br>
Line 28: Line 32:
 
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/<br>
 
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/<br>
  
==Structured Information==
+
=='''Labs working on this gene'''==
LOCUS      AB013448              10322 bp    DNA    linear  PLN 15-FEB-2008
+
1.International Rice Research Institute (IRRI), DAPO Box 7777, Metro Manila, Philippines; <br>
DEFINITION  Oryza sativa Japonica Group gene for Pib, complete cds.
+
2.Japan International Research Center for Agricultural Sciences (JIRCAS), 1-1, Ohwashi, Tsukuba, Ibaraki 305-8686, Japan; <br>
ACCESSION  AB013448
+
3.Indonesian Center for Rice Research (ICRR), JL. Raya Muara No. 25A Ciapus Bogor, Subang, West Java, Indonesia; <br>
VERSION    AB013448.1 GI:4521189
+
4.Agricultural Genetics Institute, Conhue, Tuliem, Hanoi, Vietnam; <br>
KEYWORDS    .
+
5.Faculty of Agricultural Sciences, University of Burundi, BP 2940 Bujumbura, Burundi; <br>
SOURCE      Oryza sativa Japonica Group (Japanese rice)
+
 
  ORGANISM  Oryza sativa Japonica Group
+
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
=='''related Link'''==
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
NCBI GeneBank : [http://www.ncbi.nlm.nih.gov/nuccore/4521189]
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
[http://www.ncbi.nlm.nih.gov/nuccore/4689079]
REFERENCE  1
 
  AUTHORS  Wang,Z.X., Yano,M., Yamanouchi,U., Iwamoto,M., Monna,L.,
 
            Hayasaka,H., Katayose,Y. and Sasaki,T.
 
  TITLE    The Pib gene for rice blast resistance belongs to the nucleotide
 
            binding and leucine-rich repeat class of plant disease resistance
 
            genes
 
  JOURNAL  Plant J. 19 (1), 55-64 (1999)
 
  PUBMED  10417726
 
REFERENCE  2  (bases 1 to 10322)
 
  AUTHORS  Sasaki,T. and Yano,M.
 
  TITLE    Direct Submission
 
  JOURNAL  Submitted (28-APR-1998) Contact:Takuji Sasaki National Institute of
 
            Agrobiological Resources, Rice Genome Research Program; Kannondai
 
            2-1-2, Tsukuba, Ibaraki 305-8602, Japan
 
FEATURES            Location/Qualifiers
 
    source          1..10322
 
                    /organism="Oryza sativa Japonica Group"
 
                    /mol_type="genomic DNA"
 
                    /cultivar="Tohoku IL-9"
 
                    /db_xref="taxon:39947"
 
                    /chromosome="2"
 
                    /clone="cos140/EagI10k"
 
                    /tissue_type="green leaf"
 
    gene            2293..9202
 
                    /gene="PIB"
 
    mRNA            join(2293..2446,2570..2698,3509..4586,5927..6682,
 
                    6991..9202)
 
                    /gene="PIB"
 
    CDS            join(3573..4586,5927..6682,6991..8976)
 
                    /gene="PIB"
 
                    /codon_start=1
 
                    /product="Pib"
 
                    /protein_id="BAA76281.2"
 
                    /db_xref="GI:37777009"
 
                    /translation="MEATALSVGKSVLNGALGYAKSAFAEEVALQLGIQKDHTFVADE
 
                    LEMMRSFMMEAHEEQDNSKVVKTWVKQVRDTAYDVEDSLQDFAVHLKRPSWWRFPRTL
 
                    LERHRVAKQMKELRNKVEDVSQRNVRYHLIKGSAKATINSTEQSSVIATAIFGIDDAR
 
                    RAAKQDNQRVDLVQLINSEDQDLKVIAVWGTSGDMGQTTIIRMAYENPDVQIRFPCRA
 
                    WVRVMHPFSPRDFVQSLVNQLHATQGVEALLEKEKTEQDLAKKFNGCVNDRKCLIVLN
 
                    DLSTIEEWDQIKKCFQKCRKGSRIIVSSTQVEVASLCAGQESQASELKQLSADQTLYA
 
                    FYDKGSQIIEDSVKPVSISDVAITSTNNHTVAHGEIIDDQSMDADEKKVARKSLTRIR
 
                    TSVGASEESQLIGREKEISEITHLILNNDSQQVQVISVWGMGGLGKTTLVSGVYQSPR
 
                    LSDKFDKYVFVTIMRPFILVELLRSLAEQLHKGSSKKEELLENRVSSKKSLASMEDTE
 
                    LTGQLKRLLEKKSCLIVLDDFSDTSEWDQIKPTLFPLLEKTSRIIVTTRKENIANHCS
 
                    GKNGNVHNLKVLKHNDALCLLSEKVFEEATYLDDQNNPELVKEAKQILKKCDGLPLAI
 
                    VVIGGFLANRPKTPEEWRKLNENINAELEMNPELGMIRTVLEKSYDGLPYHLKSCFLY
 
                    LSIFPEDQIISRRRLVHRWAAEGYSTAAHGKSAIEIANGYFMELKNRSMILPFQQSGS
 
                    SRKSIDSCKVHDLMRDIAISKSTEENLVFRVEEGCSAYIHGAIRHLAISSNWKGDKSE
 
                    FEGIVDLSRIRSLSLFGDWKPFFVYGKMRFIRVLDFEGTRGLEYHHLDQIWKLNHLKF
 
                    LSLRGCYRIDLLPDLLGNLRQLQMLDIRGTYVKALPKTIIKLQKLQYIHAGRKTDYVW
 
                    EEKHSLMQRCRKVGCICATCCLPLLCEMYGPLHKALARRDAWTFACCVKFPSIMTGVH
 
                    EEEGAMVPSGIRKLKDLHTLRNINVGRGNAILRDIGMLTGLHKLGVAGINKKNGRAFR
 
                    LAISNLNKLESLSVSSAGMPGLCGCLDDISSPPENLQSLKLYGSLKTLPEWIKELQHL
 
                    VKLKLVSTRLLEHDVAMEFLGELPKVEILVISPFKSEEIHFKPPQTGTAFVSLRVLKL
 
                    AGLWGIKSVKFEEGTMPKLERLQVQGRIENEIGFSGLEFLQNINEVQLSVWFPTDHDR
 
                    IRAARAAGADYETAWEEEVQEARRKGGELKRKIREQLARNPNQPIIT"
 
ORIGIN     
 
        1 cggccgcata atacgactca ctatagggat ctcctctaga gttactttgc cgtgctccat
 
      61 actatcctat tctatattgg attatactat cgatccaacg attcagatta actctatact
 
      121 agtgaagtct acacttatgg tatgggtaat atacatatgt agtatagtat agcataaggg
 
      181 tatttcattt tgcaggttag ccgtttatct gctggtgctc ctcttgctgt agtagtgttg
 
      241 ttggtgttgc tgctgatgac ctaaaatgct tgcatgtttc tatcatgttc tccataatgt
 
      301 agtatcatgt actccatctt ccttgttggt ttttgtccat aatctccacc ttggcagctt
 
      361 gcatcatctt actctcgagc ttgtccacct tgagattcaa ctcctggaac gcggctccca
 
      421 gttcatccac cctcttctcc acggcaggaa tccgtgactc caccgtacgc ttgagatctt
 
      481 ggtactccgc cctggtgcgc tcatcagcct caactcgttt cttctcattc ccttccacaa
 
      541 gttgcagaag gaggtccaac ttcttatcag tctccatggc ctcggatctg gatcaggtac
 
      601 ctactgctct cgctccgaat tccgcgaacc ttagggggca agtttccttt tcgcggtgcc
 
      661 gatccgaaga tcagctccaa tccaccccaa ggaacaattt caccgcagaa tcaagagaat
 
      721 ttgagaagca agagaggctc tgataccaga ttgtcaggat ctcaagaaat cagcaaagaa
 
      781 caacaagaac acacaaggat tcaggcaact agtttggatt gatctgctcc aacccaacag
 
      841 gattgagcct tccgccgcca ccgccaccga gttgccagtt catagttgtc tttctcgagt
 
      901 tcatcttatt tatacagtag tatctcccta ctcacacgac acacacagta gccagctgta
 
      961 caacagatag ctgggctacg caacccactc ggacccatgg taacgaggat tgggctttgg
 
    1021 ccctcttgtg ggtcttgctc ttcctggagt agtagtctgt atctcctcct cctggacttc
 
    1081 agcttctgct tcatcaggtt ctccttcttc aggttccttc tctccctgtt cagcttctgc
 
    1141 ttcatcaggt tctccttctt cagtacccat agtgacaggc aggttcctga caaaattctg
 
    1201 ctcgtttgcg accaatggta gtgatcatag ttgcaaccag gagggggggg ggggaaatcg
 
    1261 ccgtcccctc cgctcctctc ccgtcgtccc caacgcctcg ttcgcgcatt tcgttgaaca
 
    1321 ccatgacggc gccgaattcg cagtgtccgc acatctcctc ctcccccgtc ctctccaaac
 
    1381 cccaaaccct atctccaccc ccgaggcagg cgcccccatg cacttgtaag tcgattggat
 
    1441 gtcctgtccc agaagacata tcgagcgagg aggcggaggg ggacgaaggg aacatatcga
 
    1501 gcgaggaagc ggagggtgga tcggcatccc ccatttcaag gtactatact agtccattat
 
    1561 agtagtagtg cttttgcatc ttagaaaaaa aaatatgttc attagccatt gagagcttct
 
    1621 gaagttgttg attttgttcc aaccccaact gtgagtttca gttcaggtca tccactgatt
 
    1681 ttcactatgc caattctctg aaacaacttt accactgtca catgaacaca ctgaaacagt
 
    1741 ttggtgtaga cgtgtagtga agaatgtagc atatatacct tcacttaatt tttcttgcaa
 
    1801 ttattggcca ttactagtta tgcgaggtag aagtgttcta aggtactgta tcatttttat
 
    1861 gtactaatta attaagttta ataaaaactt ttattatcta aaaataaatg actattacta
 
    1921 gctcggtact ccctttattt tatattataa gacgttttga tttttttata tacaactttc
 
    1981 tttaagtttg attatactta taaaaaatta gcaaacatat atattttttt tacattaata
 
    2041 gtgcaagtga gcacgcttaa atgcattgta cttccttcgt aaaaaaacat caaactttta
 
    2101 cggacgaata tggataaatg catatctaaa ttcatcctca ataattgatt ctttttggag
 
    2161 gagtacaatt ggttggtgcg ctttgtcctt ggaccctaca ataatgatga ttgtttcttt
 
    2221 aatctattga ccttgactta ccacatgggc tatgtttatc ccttcctgaa tcctgagcac
 
    2281 tgactaccga ggcaccgagt gtgagcggca acggcggtca gggagcaggc gtggctcgtc
 
    2341 ggcgagcggc tacgggcaac ggcgccttgg cgtcaggcat ccgccgtcac tcacctcaag
 
    2401 cttgcgggct ctgcgaccac cctctcatag tcataggcca cagaaggtgt agtagtactt
 
    2461 catacatttc gagcagtttc tttcagattg tttgtttttg agcttctaat tttgggatgc
 
    2521 attagatagt gatgaaagcc tgaattattg gaattttggt gttggtactc acactctcac
 
    2581 agtcagaaca tactcctata tattttgcag cacatttgcc ttgtgcgtgc tgttcgtctg
 
    2641 ttccactcgt gaacatcaga cgcgaagatt atagattcac ccctgttcac agattcaggt
 
    2701 actgccaatt gcctggatga acaccagtcc atttgctctc tttcgcctta caatttttct
 
    2761 ctgcattgta ctagcagccg tagctcgaaa gcctcgaata tgattccttt tcaagatttt
 
    2821 atatttatgg aatataattc acttttaaga tgccttgatg gtgaaatagt agacatgtga
 
    2881 gactccaaat ctcgtcctaa aagagcatgg aggtaaaaaa agaaaaaggt agacatcgct
 
    2941 attgtagaca tggagagctg gaatacgatt actttcaaga tattatattc aatgagcatt
 
    3001 cattcttaca catatgccac aaaggtaaaa aaaaacagag aaagagagag agaggggaaa
 
    3061 gaagccaagt tctttcttct actatcattt aggttgagtt cgtttgttaa ggttcccaac
 
    3121 ctacgattcc tcgtttcccg cgtgcacgat tcccaaacta ctaaatggta tgctttttaa
 
    3181 aatatttcgt agaaaaattg ctttaaaaaa tcatattaat ttatttttta agttgtttag
 
    3241 ctaatactca attaatcatg cattaatttg ccgctccgtt ttagtggaag tcatctgaaa
 
    3301 ggatcaaagg aagcaacacc aagtccttat ttcgactccg actctctcac tctcgccatt
 
    3361 tattcttttc tttctgttat tttaaaagtt gctactttag cttcagccac gtgaattctt
 
    3421 gatatttcat tatttttctc atcaaacaat agcatcttct tctggaaatc gaattcaggg
 
    3481 cttatatgtt gcttattctg atatataggt ctgtcacgag gcgtatgatc atcaactctg
 
    3541 ccacaaaatc cattcaaaaa tagaacagag caatggaggc gacggcgctg agtgtgggca
 
    3601 aatccgtgct gaatggagcg cttggctacg caaaatctgc atttgctgag gaggtggcct
 
    3661 tgcagcttgg tatccagaaa gaccacacat ttgttgcaga tgagcttgag atgatgaggt
 
    3721 ctttcatgat ggaggcgcac gaggagcaag ataacagcaa ggtggtcaag acttgggtga
 
    3781 agcaagtccg tgacactgcc tatgatgttg aggacagcct ccaggatttc gctgttcatc
 
    3841 ttaagaggcc atcctggtgg cgatttcctc gtacgctgct cgagcggcac cgtgtggcca
 
    3901 agcagatgaa ggagcttagg aacaaggtcg aggatgtcag ccagaggaat gtgcggtacc
 
    3961 acctcatcaa gggctctgcc aaggccacca tcaattccac tgagcaatct agcgttattg
 
    4021 ctacagccat attcggcatt gacgatgcaa ggcgtgccgc aaagcaggac aatcagagag
 
    4081 tggatcttgt ccaactaatc aacagtgagg atcaggacct aaaagtgatc gcggtctggg
 
    4141 gaacaagtgg tgatatgggc caaacaacaa taatcaggat ggcttatgag aacccagatg
 
    4201 tccaaatcag attcccatgc cgtgcatggg taagggtgat gcatcctttc agtccaagag
 
    4261 actttgtcca gagcttggtg aatcagcttc atgcaaccca aggggttgaa gctctgttgg
 
    4321 agaaagagaa gacagaacaa gatttagcta agaaattcaa tggatgtgtg aatgatagga
 
    4381 agtgtctaat tgtgcttaat gacctatcca ccattgaaga gtgggaccag attaagaaat
 
    4441 gcttccaaaa atgcaggaaa ggaagccgaa tcatagtgtc aagcactcaa gttgaagttg
 
    4501 caagcttatg tgctgggcaa gaaagccaag cctcagagct aaagcaattg tctgctgatc
 
    4561 agacccttta cgcattctac gacaaggtaa tatacttgct cttcaagcat acctctcgat
 
    4621 atcattttta attcagttat gcctttagta atttctaatt caattgtgta taggctagtt
 
    4681 gaagtgcgtg ggagttacca ttccattaga aacacatgac ctaatgcaac taacaagtgc
 
    4741 tcctcctgtt ctctctcatt tgccttttgg gaatgcatgc actcaacatt ttaagattac
 
    4801 agccaaaata tatgtatttg gatttgtcaa aacaaagatg tatgctagaa aaagaaatgg
 
    4861 tctaatacag gtttacaaat aagacaacga tgcaaaaagg gcaactaaaa acatattgat
 
    4921 tccctcatct gccactgcaa ttgccttaaa ttctagtcca ttctactatc tccgtttcat
 
    4981 attataagtc actctagttt ttttccagtc aaacttcttt agtttgacca agtttataca
 
    5041 aaaatttagc aacatatcca acacgaaatt agtttcatta aatgtagcat tgaatatatt
 
    5101 ttgatagtat gtttgttttg tgttgaaaat gctgctatat tttttaaaaa aacttggtca
 
    5161 aacctaaaca agtttgacta ggagaaaagt cgaaacgact tataatatga aatagaggga
 
    5221 gaatgttcga agtttggcta acggtcaatg ctagtgcttt aagtgggtaa gccgcaaatc
 
    5281 caattatagg ccaaaataca tgggtttgtg gcttattttg gctataagtg ggtttcgcgg
 
    5341 gttagccact tacaccccta gtcaatgcta atgaaagtag aagtgatgct attcaaggaa
 
    5401 aatgtattgg ataccgagat tgccttgaat aaagaataaa attgaggtag tagattggat
 
    5461 aatagattga cccacaaaat tgtacaagta tgtaatgtag cacaagtcct ctttgcacaa
 
    5521 ttaaaatttt gaagctccta tttcacaaat aattttgata tggattaatt gatttcatat
 
    5581 ccaattcgca cagtttattg aatttggaga tttatttcct ctatatgtga gagatgattg
 
    5641 taaaatgggc aaatctagca aatgcatcct ctcatccttt ggattaaatg tagtgtactt
 
    5701 atcccattat tttaaagtta aattaataca tattttattg aacagtcaga tatacgtttt
 
    5761 tcaaaatagg atccaaaact aaggtttata ctagactgca aattaatgaa aggaattatc
 
    5821 attattgttt tgtatacttt catgaccgaa aacaaggcta aacactatcc atgtatgaaa
 
    5881 atttaaggct aaaagttgtt cttaatcatt gctccctttt gtttagggtt cccaaattat
 
    5941 agaggattca gtgaagccag tgtctatctc ggatgtggcc atcacaagta caaacaatca
 
    6001 tacagtggcc catggtgaga ttatagatga tcaatcaatg gatgctgatg agaagaaggt
 
    6061 ggctagaaag agtcttactc gcattaggac aagtgttggt gcttcggagg aatcacaact
 
    6121 tattgggcga gagaaagaaa tatctgaaat aacacactta attttaaaca atgatagcca
 
    6181 gcaggttcag gtgatctctg tgtggggaat gggtggcctt ggaaaaacca ccctagtaag
 
    6241 cggtgtttat caaagcccaa ggctgagtga taagtttgac aagtatgttt ttgtcacaat
 
    6301 catgcgtcct ttcattcttg tagagctcct taggagtttg gctgagcaac tacataaagg
 
    6361 atcttctaag aaggaagaac tgttagaaaa tagagtcagc agtaagaaat cactagcatc
 
    6421 gatggaggat accgagttga ctgggcagtt gaaaaggctt ttagaaaaga aaagttgctt
 
    6481 gattgttcta gatgatttct cagatacctc agaatgggac cagataaaac caacgttatt
 
    6541 ccccctgttg gaaaagacaa gccgaataat tgtgactaca agaaaagaga atattgccaa
 
    6601 ccattgctca gggaaaaatg gaaatgtgca caaccttaaa gttcttaaac ataatgatgc
 
    6661 attgtgcctc ttgagtgaga aggtaatata agtgtgctcc atttttcttg gtttgatatt
 
    6721 cttttaatca tttgagttat ccaatcaaga tgatatttgt gcatgcagaa atagcatata
 
    6781 ctagattcat atacaactta atctgttctc acaacaatag caatgcagtt cctaaaatga
 
    6841 cctgcattgg atggacgtta gatgtgactt tgtttttgta tgtaatggtg gccttcattc
 
    6901 cttagtttta atagtaaaga cgtatttcta aatttaattt tttttgtttt actttagagc
 
    6961 acaataaagc ttaaattgta tcaatgtcag gtatttgagg aggctacata tttggatgat
 
    7021 cagaacaatc cagagttggt taaagaagca aaacaaatcc taaagaagtg cgatggactg
 
    7081 ccccttgcaa tagttgtcat aggtggattc ttggcaaacc gaccaaagac cccagaagag
 
    7141 tggagaaaat tgaacgagaa tatcaatgct gagttggaaa tgaatccaga gcttggaatg
 
    7201 ataagaaccg tccttgaaaa aagctatgat ggtttaccat accatctcaa gtcatgtttt
 
    7261 ttatatctgt ccattttccc tgaagaccag atcattagtc gaaggcgttt ggtgcatcgt
 
    7321 tgggcagcag aaggttactc aactgcagca catgggaaat ctgccattga aatagctaac
 
    7381 ggctacttca tggaactcaa gaatagaagc atgattttac cattccagca atcaggtagc
 
    7441 agcaggaaat caattgactc ttgcaaagtc catgatctca tgcgtgacat cgccatctca
 
    7501 aagtcaacgg aggaaaacct tgtttttagg gtggaggaag gctgcagcgc gtacatacat
 
    7561 ggtgcaattc gtcatcttgc tataagtagc aactggaagg gagataagag tgaattcgag
 
    7621 ggcatagtgg acctgtcccg aatacgatcg ttatctctgt ttggggattg gaagccattt
 
    7681 tttgtttatg gcaagatgag gtttatacga gtgcttgact ttgaagggac tagaggtcta
 
    7741 gaatatcatc accttgatca gatttggaag cttaatcacc taaaattcct ttctctacga
 
    7801 ggatgctatc gtattgatct actgccagat ttactgggca acctgaggca actccagatg
 
    7861 ctagacatca gaggtacata tgtaaaggct ttgccaaaaa ccatcatcaa gcttcagaag
 
    7921 ctacagtaca ttcatgctgg gcgcaaaaca gactatgtat gggaggaaaa gcatagttta
 
    7981 atgcagaggt gtcgtaaggt gggatgtata tgtgcaacat gttgcctccc tcttctttgc
 
    8041 gaaatgtatg gccctctcca taaggcccta gcccggcgtg atgcgtggac tttcgcttgc
 
    8101 tgcgtgaaat tcccatctat catgacggga gtacatgaag aggaaggcgc tatggtgcca
 
    8161 agtgggatta gaaaactgaa agacttgcac acactaagga acataaatgt cggaagggga
 
    8221 aatgccatcc tacgagatat cggaatgctc acaggattac acaagttagg agtggctggc
 
    8281 atcaacaaga agaatggacg agcgtttcgc ttggccattt ccaacctcaa caagctggaa
 
    8341 tcactgtctg tgagttcagc agggatgccg ggcttgtgtg gttgcttgga tgatatatcc
 
    8401 tcgcctccgg aaaacctaca gagcctcaag ctgtacggca gtttgaaaac gttgccggaa
 
    8461 tggatcaagg agctccagca tctcgtgaag ttaaaactag tgagtactag gctattggag
 
    8521 cacgacgttg ctatggaatt ccttggggaa ctaccgaagg tggaaattct agttatttca
 
    8581 ccgtttaaga gtgaagaaat tcatttcaag cctccgcaga ctgggactgc ttttgtaagc
 
    8641 ctcagggtgc tcaagcttgc aggattatgg ggcatcaaat cagtgaagtt tgaggaagga
 
    8701 acaatgccca aacttgagag gctgcaggtc caagggcgaa tagaaaatga aattggcttt
 
    8761 tctgggttag agtttctcca aaacatcaac gaagtccagc tcagtgtttg gtttcccacg
 
    8821 gatcatgata ggataagagc cgcgcgcgcc gcgggcgctg attatgagac tgcctgggag
 
    8881 gaagaggtac aggaagcaag gcgcaaggga ggtgaactga agaggaaaat ccgagaacag
 
    8941 cttgctcgga atccaaacca acccatcatt acctgagctc ctttggagtt actttgccgt
 
    9001 gctccatact atcctacaag tgagatcctc tgcagtactg catgctcact gacatgtgga
 
    9061 cccgaggggc tgtggggccc acatgtcagt gagcagtact gtgcagtact gcagaggacc
 
    9121 tgcatccact atcctatatt ataatggatt gtactatcga tccaactatt cagattaact
 
    9181 ctatactagt gaacttattt ttttttgccg ggccggcaaa tagctggtcg atgtatatta
 
    9241 agaataagaa agggaatgta caagatagcg cggtgcgtca atgcaccacc attacagacg
 
    9301 taaaaggaaa gctaaaatct cacagaatga gttgctacag agtgacacat ggggctaaca
 
    9361 agacctgcag ctatccaagt ctcccattca tcccccatgg cagaacagaa ctggggaacc
 
    9421 gttgccgcga tcccttcaaa cacccttgcg tttcgctctt tcgaaatcaa ccaggttaca
 
    9481 aggatcaccc ttgcatcgaa cgttttgcgg tcaaccttag caacagattt ccgggctgca
 
    9541 agccaccaat cagcaaaatc agccgacgat gaggagcacg aaaggaccag gcgtgtgcgc
 
    9601 acctgacctc aaatctcctg ggtgtaagag cagcccacga agatgtgctg gcaggtttcc
 
    9661 ccgtcattgg agcagaaata gcacaccgga gcaagcttcc atctgtgacg ttgtagattg
 
    9721 ttggcagtga ggcaagcatt gcgctcggcg agaaacataa agaacttaca tctcgccggg
 
    9781 gcaagagact tccaaataat ggtatacata tgtagtatat agtatagtat agtatagtat
 
    9841 aagggtattc attttgcagg ttagcggtta tctgctgctg ttcctcctgc tgcggcgtgc
 
    9901 tggagtagtg ttgttggtgg tggtgctgat gacctaaaat gcttgcttgt ttctatcaag
 
    9961 ttctccagaa tgtagtatgt actgcatctt gttgattttt gtccataaac ggattgcatt
 
    10021 atctgtatat gacccaatca acaataaacg gtgttgcatt ttgttcctaa aagctcttag
 
    10081 agtctgacca gttatctctg tacgcatctt catgctgttc tttgggcact ggtcatggtt
 
    10141 aaatcacagt tcaccgaaac ttattttctg tagacttatt ctgaaatact gagaaattga
 
    10201 aatgtagtaa ctattgtctg tagactgctt tctcgttttt cttttgcggt cgccatctcc
 
    10261 agtcagtatc tacagaagaa gagccaatgc agcctattgt cctttttttg ccgggtcggc
 
    10321 cg
 
//
 

Latest revision as of 06:27, 6 June 2014

Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).

Annotated Information

Gene structure

The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus positions indicating that they are likely to be buried in the hydrophobic core of the protein.

Figure1 gene struture.png

Function

The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.

Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.

Expression

Figure2 expression.jpg

The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases. Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.

There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.

Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.

References

1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka, A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675</ref> 4.Wang Z X,Yamanouchi U,Katayose Y,et al., 2001, Expression of the pib rice blast resistance gene family is up - regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses[J] . Plant Molecular Biology, 47: 653- 661.
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/

Labs working on this gene

1.International Rice Research Institute (IRRI), DAPO Box 7777, Metro Manila, Philippines;
2.Japan International Research Center for Agricultural Sciences (JIRCAS), 1-1, Ohwashi, Tsukuba, Ibaraki 305-8686, Japan;
3.Indonesian Center for Rice Research (ICRR), JL. Raya Muara No. 25A Ciapus Bogor, Subang, West Java, Indonesia;
4.Agricultural Genetics Institute, Conhue, Tuliem, Hanoi, Vietnam;
5.Faculty of Agricultural Sciences, University of Burundi, BP 2940 Bujumbura, Burundi;


related Link

NCBI GeneBank : [1] [2]