Difference between revisions of "Os07g0682800"

From RiceWiki
Jump to: navigation, search
(Function)
(Annotated Information)
Line 8: Line 8:
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
In Arabidopsis, a lot of root hair mutants are available, and many genes involved in the root hair morphogenesis have been isolated (Grierson and Schiefelbein 2002). On the other hand, rice has a more complicated pattern of root hair formation (Kawata and Ishihara 1959). Only two root hair mutants in rice have been reported (Suzuki et al. 2003, Kim et al. 2007), and, causal gene was isolated in only one mutant (Kim  et al. 2007). A mutant gene, root hairless 1 (rth1) reported by Suzuki et al. (2003), remains unidentified. Thus, genetic studies on root hairs in rice lag behind compared to Arabidopsis. In the present study, we have identified a new root hair mutant gene, rth1 in rice by means of positional cloning. We describe morphological and physiological characteristics, and gene expression pattern in rth1 mutant. We revealed that
 +
RTH1 encodes an enzyme apyrase that can hydrolyze NTPs and/or diphosphates (Shibata et al. 1999) and that apyrase is a key gene for root hair elongation and plant growth in rice.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.

Revision as of 07:24, 6 June 2014

Please input one-sentence summary here.

Annotated Information

Root hairs, projections from the epidermal cells of the roots, are contributing to water and nutrient uptake and anchorage to the soil.

Function

Root hairs, projections from the epidermal cells of the roots, are contributing to water and nutrient uptake and anchorage to the soil.. SEM observation showed that in rth1 plants, root hair elongation was abolished after the formation of bulge. High-resolution mapping using 2,088 segregants revealed three predicted genes in a 38-kb candidate interval on chromosome 7. Sequences comparison of the three genes between wild-type Oochikara and rth1 detected a nucleotide substitution only in apyrase (OsAPY). This nucleotide substitution (G→A) lies in the junction between the third intron and the forth exon, and results in the splicing anomaly to the rth1 cDNA sequence. Transgenic plants with introduced OsAPY allele restored normal root hairs and plant growth, showing a complementation of rth1 phenotype. We concluded that the root hairless phenotype of rth1 is caused by a mutation of OsAPY. OsAPY appears to be an important gene for root hair elongation and plant growth in rice.

Expression

In Arabidopsis, a lot of root hair mutants are available, and many genes involved in the root hair morphogenesis have been isolated (Grierson and Schiefelbein 2002). On the other hand, rice has a more complicated pattern of root hair formation (Kawata and Ishihara 1959). Only two root hair mutants in rice have been reported (Suzuki et al. 2003, Kim et al. 2007), and, causal gene was isolated in only one mutant (Kim et al. 2007). A mutant gene, root hairless 1 (rth1) reported by Suzuki et al. (2003), remains unidentified. Thus, genetic studies on root hairs in rice lag behind compared to Arabidopsis. In the present study, we have identified a new root hair mutant gene, rth1 in rice by means of positional cloning. We describe morphological and physiological characteristics, and gene expression pattern in rth1 mutant. We revealed that RTH1 encodes an enzyme apyrase that can hydrolyze NTPs and/or diphosphates (Shibata et al. 1999) and that apyrase is a key gene for root hair elongation and plant growth in rice.

Evolution

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os07g0682800

Description

Similar to Apyrase-like protein

Version

NM_001067198.1 GI:115474128 GeneID:4344315

Length

4110 bp

Definition

Oryza sativa Japonica Group Os07g0682800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:29623302..29627411

Sequence Coding Region

29623630..29623941,29624037..29624165,29624248..29624304,29624406..29624498,29625015..29625220
,29625700..29625794,29626421..29626635,29626718..29626907,29627000..29627106

Expression

GEO Profiles:Os07g0682800

Genome Context

<gbrowseImage1> name=NC_008400:29623302..29627411 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:29623302..29627411 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcgccgctactccgcgctgcccggcggcggcgcccgccccgacacgctcgccgaccgcctccaccgctaccgcggcgtcctcctcgtcatcctcgccccgctcgccctcgtctccctcgtcctcctcctcatgccgcgctcccccgcctcctcctccgccgccgccggcaggaggtggggccccctcgacgccaacaagtacgccgtcattttcgacgccgggagctccgggagccgcgtccacgtcttccgcttcgacgccaacctcgatctgctccacattggcgaccagatcgagctcttcgtccagaaaaagccggggcttagcgagtacgccaataacccgcaggaggctgccaaatcgctcgtctctctccttgaggatgccaaacgagtggttcccgtggaattgcgcggccagactcctgttagagttggggccaccgccgggctaagagcgttgggagcagaaaaatcagaggagattttgcaagcggtcagggatcttcttcgcgaaaagagttcgttcaagacccaaccggattgggttacagttcttgatggacctcaggaaggcgcatatgaatgggttaccatcaattatctgctggggaaattgggaaagacttacgcagacacagttggagtggttgatcttggaggtggatctgtgcagatggcatatgcaattgcagagaaggatgcagtgaaggctcctaaaccatcagagggtgaagattcatatgtgaagaaactgtttcttaaaggaacaacatattatctttatgttcacagctatttgcattatgggttgctggctgctagagcagagatcttaaaagccggcaatggcaaaggttacagctactgtacattggaggggcatcaagggcaatacaaatatggcaatggcaaatttgaagcgtcggcttcaccatctggtgctagttattcaaaatgcagggatgatgtagtgaaagctcttaaagttgaccaagcatgcactcacatgaaatgttcttttggtggcatttggaatggtggtggtggcgctggacagaagaatttgtttgtggcatcatttttcttcgacagggcagctgaggctggatttgtgaatcccaaggcacctgtggctaaggttaaaccttcagattttgaaaaggctgccaagcgtgcatgtaagttaaacttgaaggacgccgaagctgcctaccctggtgtccaaaaggataacattccatatatctgcatggatctcgtttaccagtacaccttacttgtggatggatttggtgttggttctcaccaagagatgaccttggtaaagaaagtcccttacagcaacgcgtttgtggaagcagcatggccactgggaagtgccattgaggttgcatcttga</cdnaseq>

Protein Sequence

<aaseq>MRRYSALPGGGARPDTLADRLHRYRGVLLVILAPLALVSLVLLL MPRSPASSSAAAGRRWGPLDANKYAVIFDAGSSGSRVHVFRFDANLDLLHIGDQIELF VQKKPGLSEYANNPQEAAKSLVSLLEDAKRVVPVELRGQTPVRVGATAGLRALGAEKS EEILQAVRDLLREKSSFKTQPDWVTVLDGPQEGAYEWVTINYLLGKLGKTYADTVGVV DLGGGSVQMAYAIAEKDAVKAPKPSEGEDSYVKKLFLKGTTYYLYVHSYLHYGLLAAR AEILKAGNGKGYSYCTLEGHQGQYKYGNGKFEASASPSGASYSKCRDDVVKALKVDQA CTHMKCSFGGIWNGGGGAGQKNLFVASFFFDRAAEAGFVNPKAPVAKVKPSDFEKAAK RACKLNLKDAEAAYPGVQKDNIPYICMDLVYQYTLLVDGFGVGSHQEMTLVKKVPYSN AFVEAAWPLGSAIEVAS</aaseq>

Gene Sequence

<dnaseqindica>329..640#736..864#947..1003#1105..1197#1714..1919#2399..2493#3120..3334#3417..3606#3699..3805#agcagcgaacccctctctcgccgcagatcccaacgccgcacacacacgcacacgcacccgcacgcgcacgcatttccagctcgcgacgacgcccatctcgacgcgacgcgatccccgccaagtcaaaccccacccgttatactctccactgcgatctcagaggcagaggcagagcccacgccgcgcagatccacctctctccgccctggattccgcggagcaggaggcggtcaagccgtcgccgccgccgccgggccgcatccgctaccgcacgccctcctccccggacctcctcctcgccccgccctccgacgccgacgccaagaacatgcgccgctactccgcgctgcccggcggcggcgcccgccccgacacgctcgccgaccgcctccaccgctaccgcggcgtcctcctcgtcatcctcgccccgctcgccctcgtctccctcgtcctcctcctcatgccgcgctcccccgcctcctcctccgccgccgccggcaggaggtggggccccctcgacgccaacaagtacgccgtcattttcgacgccgggagctccgggagccgcgtccacgtcttccgcttcgacgccaacctcgatctgctccacattggcgaccagatcgagctcttcgtccaggtgatccatccacccaattggatctggatctgctagggatcctttcatctctcaatccatttttacttaatttccccccacttccccttttgcagaaaaagccggggcttagcgagtacgccaataacccgcaggaggctgccaaatcgctcgtctctctccttgaggatgccaaacgagtggttcccgtggaattgcgcggccagactcctgttagagttggggtgagttcttgtacgataccagtagagcttcctattgctgcttggtcatcttctaataataagctttataattcacacacaggccaccgccgggctaagagcgttgggagcagaaaaatcagaggagattttgcaagcggtaaattttgcttttattcacctttgattaattgttgtttgatcgatcactgaatttatattggttgtccctaatattgaatacactcacaatttttgcaggtcagggatcttcttcgcgaaaagagttcgttcaagacccaaccggattgggttacagttcttgatggacctcaggaaggcgcatatgaatgggtacaaaactggcctgatttattcatatggttcagaacattactttgtgctcctgattattagaaatgcctcacatttgtcagattgacaatataagttctttttgtttagaaaaaactattttgttcagcaacaaatctgccaattctcttagagctgacatctgccagcttcaaagatataagttttaaaggacatgataaaaaaagagaaattttcgctttcatgagtgaattaggcaaaataactattttcatttttgaaaaacaaaatttgggcaccagaaacaaatgacgaaacaaaatccaaatgacgaaagctaaacattgaaagtaagggcaccagaaacaacattttccctgaaaatagatgcagatcatctgaatccatgtggtgcactgttctgacagttaattcaccttttgagtgtttaggatctgttcacaactagtgattctatgtctagcttttagtccattaactgataacaagtgttgctcttctctatccttataggttaccatcaattatctgctggggaaattgggaaagacttacgcagacacagttggagtggttgatcttggaggtggatctgtgcagatggcatatgcaattgcagagaaggatgcagtgaaggctcctaaaccatcagagggtgaagattcatatgtgaagaaactgtttcttaaaggaacaacatattatctttatgttcacaggttagtatgaaataccgttgagcttttggctgctgctacattgtcaagaaaaaagttattcagttgtgatacggtaacaatcttcaaaatccatttaagcatctgatggcatattgtcatgcctatttctgatgtctgcctatgccaattcataggttatattctttgcaaagcagacagctgttgtaatcctctaagatactatctcgtattgataaaaatgcaagaatagcgtattaatgcaaatttgagaaacttaagtccagaccaaacgtaagggtacttttatgtgtaaagattctacctaaatatcacgtggtattctatgtaatgttctacagcaaacacttaatctgacatagccacaaacttaatactccttacttttttattatctgctgtataagatgacatcacatgacctgtttttagtctggagtctttgaaccacatatataactgtacacatttcttcacagctatttgcattatgggttgctggctgctagagcagagatcttaaaagccggcaatggcaaaggttacagctactgtacattggaggggcatcaaggtactagtaacatacttctaccatattcttctgctatcatttaactccctgccaagtagcttatgtttgttcctaaaatttcaattgttgttacccttatgcatattttggtcaagggaggaatgtaatgcgtaggctgcattcggaggtggaggttgggaacttcacctcgccacacgcaaaacaaagcgacccattagcgcatgattaattaagcatgagctaaaataaacttgaaaaaaatggattgatataattttgtaaaacaacttacatatagaattttttttgcaaaaaaaaaaaacaccgtttagcagtttggcaaacgtgtgcgtggaaaacgagaaatagaagttgggaagaggtggtaaggaacacacccttatagtggatcgtaacctggtttaaatgaggttaccctcaaattctctatgaaacaaataccttactggtttccttgatattctttccaaccatcagtctgcagttagaattatttatagtgatgtgtataaatctaaatcctcatcaacacaaatgaccaatctgtgacaatagttggagatgcaattttatcttttctatgttggtaagatagttttgttctaattgcattgtgattgtagggcaatacaaatatggcaatggcaaatttgaagcgtcggcttcaccatctggtgctagttattcaaaatgcagggatgatgtagtgaaagctcttaaagttgaccaagcatgcactcacatgaaatgttcttttggtggcatttggaatggtggtggtggcgctggacagaagaatttgtttgtggcatcatttttcttcgacagggcagctgaggtaaggttgttgaactactgaagatgtttgcttttgttgccatgatgatacaccagtaaacaattttctggtctctgctcaggctggatttgtgaatcccaaggcacctgtggctaaggttaaaccttcagattttgaaaaggctgccaagcgtgcatgtaagttaaacttgaaggacgccgaagctgcctaccctggtgtccaaaaggataacattccatatatctgcatggatctcgtttaccagtacaccttacttgtggatggatttggtatgtctcgttaaaactaaatataatcaagaccgcattacagattttgcacaaatttatcactaatttgttttgctcttgcactctcgcaggtgttggttctcaccaagagatgaccttggtaaagaaagtcccttacagcaacgcgtttgtggaagcagcatggccactgggaagtgccattgaggttgcatcttgatagacagacagcagaaagttcagcaagggagctacgatcagagggcgtcatcgccgtaaagttttggatctggagggtgttcgcttgctcggcgctgcgcacgccccaagtgaccattttgttactgaaatcgattgatttaacctgcttctatacagtagcctgataatgagtgatacacaaggacccgccagcttgcatagttgcatacttgcatgcaaggggtatatacattttttttttgtaccattgaaagtaagacgagcctgtcattcttttcttgatctatactactccagttctgt</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0682800, RefSeq:Os07g0682800