Difference between revisions of "Os05g0465800"
Weilovefairy (talk | contribs) (→Annotated Information) |
Weilovefairy (talk | contribs) (→Expression) |
||
| (9 intermediate revisions by the same user not shown) | |||
| Line 16: | Line 16: | ||
decreased activity of NADPH oxidase. Taken together, these data favored the novel conclusion that PI3K regulated NADPH | decreased activity of NADPH oxidase. Taken together, these data favored the novel conclusion that PI3K regulated NADPH | ||
oxidase activity through modulating the recruitment of Rac-1 to plasma membrane and accelerated the process of rice seed | oxidase activity through modulating the recruitment of Rac-1 to plasma membrane and accelerated the process of rice seed | ||
| − | germination | + | germination. |
===Expression=== | ===Expression=== | ||
| Line 22: | Line 22: | ||
2+(below10 mM) could further increase the expression of PI3Kin rice seeds after germinated for 12 h. However, when the concentration of Ca2+ was up to 20 mM, thePI3Kexpression began to | 2+(below10 mM) could further increase the expression of PI3Kin rice seeds after germinated for 12 h. However, when the concentration of Ca2+ was up to 20 mM, thePI3Kexpression began to | ||
decrease slightly compared with the treatment with 10 mM | decrease slightly compared with the treatment with 10 mM | ||
| − | CaCl2(Figure 1B, D). | + | CaCl2(Figure 1B, D).[[File:1.jpg|right|thumb|275px|'''Figure 1.''' ''.Changes ofPI3Kexpression in rice seed after imbibition...(from reference) <ref name="ref1" />.'']] |
| − | LY294002 and Wortmannin inhibit | + | |
| − | + | LY294002 and Wortmannin inhibit ROS production.To further investigate this relationship between PI3K and ROS, | |
| − | + | ROS probe H2 | |
| − | the | + | DCFDA was used to examine the characteristics of |
| − | + | ROS production under the treatment of pharmacological | |
| − | + | inhibitors of PI3K LY294002 (60 mM) or Wortmannin (20mM).[[File:2.jpg|right|thumb|275px|'''Figure 2.''' ''.The effect of PI3K inhibitors LY294002 and Wortmannin on seed germination in rice...(from reference) <ref name="ref1" />.'']] | |
| − | + | LY294002 and Wortmannin inhibit the expression of | |
| − | + | NADPH oxidase | |
| − | + | The earlier studies have reported that NADPH oxidasegenerated ROS plays a key role in seed germination [7,35,36]. | |
| − | + | As mentioned above, PI3K inhibitors can prevent ROS | |
| − | + | production during rice seed germination. Therefore, it is worth | |
| − | ( | + | assuming that PI3K might control ROS level via regulating |
| − | + | NADPH oxidase. In the previous study, it has been proved that PI3K is associated with nuclear transcription sites in higher plant.[[File:3.jpg|right|thumb|275px|'''Figure 3.''' ''..PI3K inhibitors LY294002 and Wortmannin suppressed the ROS generation in rice seed embryos during | |
| − | + | germination. .(from reference) <ref name="ref1" />.'']] | |
| − | + | ||
| − | germination. | ||
| − | |||
| − | PI3K inhibitors | ||
| − | |||
| − | that PI3K | ||
| − | |||
| − | |||
| − | inhibitors | ||
| − | |||
| − | |||
===Evolution=== | ===Evolution=== | ||
| − | + | PI3K inhibitors suppress the activity of NADPH oxidase.the NADPH oxidase enzymatic activity | |
| + | was also examined by the measurement of the XTT formazan | ||
| + | concentration with 60mM LY294002 or 20mM Wortmannin. | ||
| + | The experimental result showed that the LY294002 and | ||
| + | Wortmannin inhibited NADPH oxidase activity by 36.6% and | ||
| + | 18.2%, respectively. | ||
| + | Together with the above work, the data presented here provided | ||
| + | a comprehensive view of the mechanism of PI3K-dependent seed | ||
| + | germination with ROS as key signaling elements in rice seed | ||
| + | germination. A scheme showing this mechanism was presented in | ||
| + | Figure 8. We proposed that PI3K could promote the translocation | ||
| + | of Rac-1 to membrane, and then elevated the activity of NADPH | ||
| + | oxidase, finally increased the formation of ROS. The elevated ROS | ||
| + | level could trigger carbonylation of proteins and this was specifically | ||
| + | associated with seed germination. | ||
| − | + | ==Labs working on this gene== | |
| − | + | MOE Key Laboratory of Laser Life Science and Institute of Laser Life Science, College of Biophotonics, South China Normal University, Guangzhou, China | |
| − | |||
==References== | ==References== | ||
| − | + | <references> | |
| + | <ref name="ref1">Jian Liu;Jun Zhou;Da Xing | ||
| + | Phosphatidylinositol 3-Kinase Plays a Vital Role in Regulation of Rice Seed Vigor via Altering NADPH Oxidase Activity | ||
| + | PLoS ONE, 2012, 7(3): e33817</ref> | ||
==Structured Information== | ==Structured Information== | ||
| Line 72: | Line 78: | ||
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP | ||
clade; Ehrhartoideae; Oryzeae; Oryza. | clade; Ehrhartoideae; Oryzeae; Oryza. | ||
| − | | | + | |Jian Liu;Jun Zhou;Da Xing |
| + | Phosphatidylinositol 3-Kinase Plays a Vital Role in Regulation of Rice Seed Vigor via Altering NADPH Oxidase Activity | ||
| + | PLoS ONE, 2012, 7(3): e33817 | ||
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]| | Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]| | ||
AP = Chromosome 5:22905974..22910867| | AP = Chromosome 5:22905974..22910867| | ||
Latest revision as of 08:19, 6 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Phosphatidylinositol 3-kinase (PI3K) has been reported to be important in normal plant growth and stress responses. In this study, it was verified that PI3K played a vital role in rice seed germination through regulating NADPH oxidase activity. Suppression of PI3K activity by inhibitors wortmannin or LY294002 could abate the reactive oxygen species (ROS) formation, which resulted in disturbance to the seed germination. And then, the signal cascades that PI3K promoted the ROS liberation was also evaluated. Diphenylene iodonium (DPI), an NADPH oxidase inhibitor, suppressed most of ROS generation in rice seed germination, which suggested that NADPH oxidase was the main source of ROS in this process. Pharmacological experiment and RT-PCR demonstrated that PI3K promoted the expression of Osrboh9. Moreover, functional analysis by native PAGE and the measurement of the 2, 3-bis-(2-methoxy-4-nitro-5-sulfophenyl)-2H-tetrazo-lium-5- carboxanilide (XTT) formazan concentration both showed that PI3K promoted the activity of NADPH oxidase. Furthermore, the western blot analysis of OsRac-1 demonstrated that the translocation of Rac-1 from cytoplasm to plasma membrane, which was known as a key factor in the assembly of NADPH oxidase, was suppressed by treatment with PI3K inhibitors, resulting in the decreased activity of NADPH oxidase. Taken together, these data favored the novel conclusion that PI3K regulated NADPH oxidase activity through modulating the recruitment of Rac-1 to plasma membrane and accelerated the process of rice seed germination.
Expression
Changes of PI3K expression in rice seed after imbibition and the expression of PI3K is regulated by Ca2+. To determine the dynamic expression ofPI3Kin rice seed germination, the total RNA was extracted from the rice seed embryo after imbibition. The result of RT-PCR analysis suggested that PI3K might involve in the regulation of seed germination. Meanwhile, it was found that the expression ofPI3K was increased with the prolongation of imbibition time (Figure 1A).This expression peaked at 12 h and reached 30 times as many as seeds without treatment (Figure 1C). Interestingly, low concentration of Ca 2+(below10 mM) could further increase the expression of PI3Kin rice seeds after germinated for 12 h. However, when the concentration of Ca2+ was up to 20 mM, thePI3Kexpression began to decrease slightly compared with the treatment with 10 mM
CaCl2(Figure 1B, D).LY294002 and Wortmannin inhibit ROS production.To further investigate this relationship between PI3K and ROS, ROS probe H2 DCFDA was used to examine the characteristics of ROS production under the treatment of pharmacological
inhibitors of PI3K LY294002 (60 mM) or Wortmannin (20mM).LY294002 and Wortmannin inhibit the expression of NADPH oxidase The earlier studies have reported that NADPH oxidasegenerated ROS plays a key role in seed germination [7,35,36]. As mentioned above, PI3K inhibitors can prevent ROS production during rice seed germination. Therefore, it is worth assuming that PI3K might control ROS level via regulating
NADPH oxidase. In the previous study, it has been proved that PI3K is associated with nuclear transcription sites in higher plant.Evolution
PI3K inhibitors suppress the activity of NADPH oxidase.the NADPH oxidase enzymatic activity was also examined by the measurement of the XTT formazan concentration with 60mM LY294002 or 20mM Wortmannin. The experimental result showed that the LY294002 and Wortmannin inhibited NADPH oxidase activity by 36.6% and 18.2%, respectively. Together with the above work, the data presented here provided a comprehensive view of the mechanism of PI3K-dependent seed germination with ROS as key signaling elements in rice seed germination. A scheme showing this mechanism was presented in Figure 8. We proposed that PI3K could promote the translocation of Rac-1 to membrane, and then elevated the activity of NADPH oxidase, finally increased the formation of ROS. The elevated ROS level could trigger carbonylation of proteins and this was specifically associated with seed germination.
Labs working on this gene
MOE Key Laboratory of Laser Life Science and Institute of Laser Life Science, College of Biophotonics, South China Normal University, Guangzhou, China
References
<references> [1]
Structured Information
| Gene Name |
Os05g0465800 |
|---|---|
| Description |
Similar to RbohAp108 |
| Version |
NM_001062318.1 GI:115464366 GeneID:4339045 |
| Length |
4894 bp |
| Definition |
Oryza sativa Japonica Group Os05g0465800, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome |
{{{Chromosome}}} |
| Location |
Chromosome 5:22905974..22910867 |
| Sequence Coding Region |
22906100..22906400,22907201..22907363,22907440..22907488,22907582..22907695,22907768..22908190 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008398:22905974..22910867 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008398:22905974..22910867 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgggggactacgtggacgtgccgctgggcggcggcgggcagagcacgctgccgccggtggcgccgctgaagaagcagccgtcgcggctggcgtccgggatgaagcggctggcgtccatggtgcccgacacgatgaagctgaagcggacgcactccagcgcgcagccggcgctgcgcggcctgcgcttcctcgacaagacgtcggcggggaaggacgggtggaagaacgtcgagaagcggttcgacgagatgagcgccgacggacgcctgccccaggagagcttcgccaaatgcatcggtatggcggattctaaggagtttgcaagcgaggtgtttgtggcattggcgagaaggaggagcatcaaaccagaagatgggataacaaaggaacagctgaaagaattttgggaggagttgactgatcagaactttgattcacgactacgaatattctttgacatgtgtgacaagaatggtgatgggcagcttacagaggacgaggtcaaagaggttattgtgttgagtgccgcagcaaacaaacttgccaagttgaaaagccatgctgcaacctacgcctcactgatcatggaagagctggatcctgatcatcgcggttacattgagatttggcagctggagacgctactccgtggtatggtgacagcccaagggcctccagagaaggtgaagctggcttcagcaagccttgcaaggacaatggtcccttccagtcaccggagtccaatgcagaggcgtttcaacaagactgttgacttcatccatgagaattggaagaggatatgggtgctctccttgtgggcgatcctcaatattgcattattcatgtacaagtttgtgcagtacagtaggcgggatgcatttcaggtgatgggctactgtgtctgcatagcaaagggtgctgccgaaacactcaagctgaacatggccgttatactcctcccggtgtgccgaaacacactaacaaggctccgatcaacagcactcagcaaagtcgtaccatttgatgataacataaacttccacaaggttatcgcactgacgattgcaattggagcggctactcatactcttgctcatgtaacctgcgacttcccaagattggtatcatgtccaagggacaagttcgaggccacactggggccttacttcaactatgttcaaccaacatactcatcgctggttgcaagcactccagggtggactggcatcctcatgatcttgataatgtcattctcgttcacacttgcgacacattcgttcaggaggagcgttgtgaagcttccatcaccactgcaccaccttgctggtttcaatgccttttggtacgcccatcacctactggtgattgcatatatcctcttggtgctgcactcctacttcatatttctcaccaagcagtggtacaatcgaacgacgtggatgttcttggcagttccagtcctcttttactcctgcgagagaactatcagaagagttcgtgagagcagttatggggtgaccgtcatcaaggcagcaatttaccctggaaatgtgctctctattcacatgaataaaccatcaagtttcaagtacaaaagtgggatgtatatgtttgtaaaatgcccagatgtttcgccttttgaatggcatcccttctccataacttctgcacctggagatgactacttgagtgttcatatccgtacattaggtgactggacaacagaacttagaaacctatttgggaaggcttgtgaggcacaagtaagttccaagaaggctacacttgcacgacttgaaaccactatcatagcagatggtctgaaagaggagacttgctttcccaaagtctttatagatggtcctttcggcgcaccagctcaaaattacaagaaatatgacattcttttgcttatcgggcttggaattggagcaacgcctttcatcagcatactgaaggatctcctgaacaacataaaatccaatggagatgtgcaaagcacgcatgatgctgagttaggctgcacctttaagagcaatgggccaggaagagcttatttctactgggtcaccagagagcaaggttcctttgaatggtttaaaggcgtgatgaatgatgttgctgaaagtgatcatgataatgtaatagagatgcacaattacctgacaagcgtgtatgaagaaggagatgcaagatcagctctgattgccatggtccaatcacttcaacatgccaaaaatggtgtggatatcgtctctggcagcaagatccggacacattttgcaaggccgaactggagaaaggtattctcagatctggccaatgcccaccagaactctcgtataggcgttttctactgtgggtctccaacacttacgaaaatgctgagggatctttcactagaattcagccagacgacaacgactcggttccatttccacaaggagaacttctaa</cdnaseq> |
| Protein Sequence |
<aaseq>MAGDYVDVPLGGGGQSTLPPVAPLKKQPSRLASGMKRLASMVPD TMKLKRTHSSAQPALRGLRFLDKTSAGKDGWKNVEKRFDEMSADGRLPQESFAKCIGM ADSKEFASEVFVALARRRSIKPEDGITKEQLKEFWEELTDQNFDSRLRIFFDMCDKNG DGQLTEDEVKEVIVLSAAANKLAKLKSHAATYASLIMEELDPDHRGYIEIWQLETLLR GMVTAQGPPEKVKLASASLARTMVPSSHRSPMQRRFNKTVDFIHENWKRIWVLSLWAI LNIALFMYKFVQYSRRDAFQVMGYCVCIAKGAAETLKLNMAVILLPVCRNTLTRLRST ALSKVVPFDDNINFHKVIALTIAIGAATHTLAHVTCDFPRLVSCPRDKFEATLGPYFN YVQPTYSSLVASTPGWTGILMILIMSFSFTLATHSFRRSVVKLPSPLHHLAGFNAFWY AHHLLVIAYILLVLHSYFIFLTKQWYNRTTWMFLAVPVLFYSCERTIRRVRESSYGVT VIKAAIYPGNVLSIHMNKPSSFKYKSGMYMFVKCPDVSPFEWHPFSITSAPGDDYLSV HIRTLGDWTTELRNLFGKACEAQVSSKKATLARLETTIIADGLKEETCFPKVFIDGPF GAPAQNYKKYDILLLIGLGIGATPFISILKDLLNNIKSNGDVQSTHDAELGCTFKSNG PGRAYFYWVTREQGSFEWFKGVMNDVAESDHDNVIEMHNYLTSVYEEGDARSALIAMV QSLQHAKNGVDIVSGSKIRTHFARPNWRKVFSDLANAHQNSRIGVFYCGSPTLTKMLR DLSLEFSQTTTTRFHFHKENF</aaseq> |
| Gene Sequence |
<dnaseqindica>127..427#1228..1390#1467..1515#1609..1722#1795..2217#2290..2676#2760..2855#2961..3076#3153..3255#3375..3463#3569..3719#3800..3949#4040..4168#4259..4337#4418..4527#tttcttcattggcctggaacgacgacgaccacgtacgccatggcgcccggggccacgctcctcctgcggtgagggcacccaccaccaccaccagcagcagcagcgggctacctagttcggatcaggatggcgggggactacgtggacgtgccgctgggcggcggcgggcagagcacgctgccgccggtggcgccgctgaagaagcagccgtcgcggctggcgtccgggatgaagcggctggcgtccatggtgcccgacacgatgaagctgaagcggacgcactccagcgcgcagccggcgctgcgcggcctgcgcttcctcgacaagacgtcggcggggaaggacgggtggaagaacgtcgagaagcggttcgacgagatgagcgccgacggacgcctgccccaggagagcttcgccaaatgcatcggtgagtgctcctgcacatgcccccatggtgttctccatcctccaaagtgattagtgattcaccacagcatgaaaagagagacggtgaaattgcattgttagcaagaacacatcgaaaattgacaagctttgttttccctgcaaaaaaaaaaggggaaaatgttgtcaaagcttttgtgcatgtgatggaaaaaggggaacagttagtagatgagaaattggtacagatcattcctagctcgtatgtcgatggtgtttgtccaaaatttcagccatttcaactgtttaagcagccagcctcctcctgccatccatgcatacatgtttgcagcacttctttgataaagtatacataatcattcctattcacaattttattttaacaaaaaacggaggaaagaaaattggaaaatttaagaggatataattggtcgaccacgggttgcacaaagttcagactttggcccccccaaatataactcggagacaatacttaccacgtagcaagaataggatatacttcctccgtttcataatgtaagactttcaatcattgcccacattcatatagatgttaatgaatctagacatatatatatgtgtatagattcattaacatctatatgaatatgggcaatgctagaaagtcttacaatatgaaacggagggagtactcgtgcttacgacattttcttttaaaagaagtgtagtcaggtaaataaatgacatcagaatagcaataaatccatcctctgtatataaattgaagctctaagcttagaatgcctctgcaacttaaaggtatggcggattctaaggagtttgcaagcgaggtgtttgtggcattggcgagaaggaggagcatcaaaccagaagatgggataacaaaggaacagctgaaagaattttgggaggagttgactgatcagaactttgattcacgactacgaatattctttgacatgtaaaggtctaccttccttgtcttcaatggaaaaaaccttatgacttgccccttgatgagattgctttgcaatcaggtgtgacaagaatggtgatgggcagcttacagaggacgaggtcaaagaggtcagttcccaatcatctctgaatttaccttttttccacaaagcttgtggaaatgatctcaataagaatttacctttctctttccatatgcaggttattgtgttgagtgccgcagcaaacaaacttgccaagttgaaaagccatgctgcaacctacgcctcactgatcatggaagagctggatcctgatcatcgcggttacattgaggtaccaagacatgaaattatctcccttttttttgacaaacagcagcatacagatatgcttgtctcaatgcagatttggcagctggagacgctactccgtggtatggtgacagcccaagggcctccagagaaggtgaagctggcttcagcaagccttgcaaggacaatggtcccttccagtcaccggagtccaatgcagaggcgtttcaacaagactgttgacttcatccatgagaattggaagaggatatgggtgctctccttgtgggcgatcctcaatattgcattattcatgtacaagtttgtgcagtacagtaggcgggatgcatttcaggtgatgggctactgtgtctgcatagcaaagggtgctgccgaaacactcaagctgaacatggccgttatactcctcccggtgtgccgaaacacactaacaaggctccgatcaacagcactcagcaaagtcgtaccatttgatgataacataaacttccacaaggtacacgtgtggaactctttgccatttccaggattacacagcctgacctctttgttctgatcaccatatcaggttatcgcactgacgattgcaattggagcggctactcatactcttgctcatgtaacctgcgacttcccaagattggtatcatgtccaagggacaagttcgaggccacactggggccttacttcaactatgttcaaccaacatactcatcgctggttgcaagcactccagggtggactggcatcctcatgatcttgataatgtcattctcgttcacacttgcgacacattcgttcaggaggagcgttgtgaagcttccatcaccactgcaccaccttgctggtttcaatgccttttggtacgcccatcacctactggtgattgcatatatcctcttggtgctgcactcctacttcatatttctcaccaagcagtggtacaatcgaacggtatttctctggcatatgtttggcacaactatttcttttgtgaattcagtggttgtgcataatattgacgcttgtgtttacagacgtggatgttcttggcagttccagtcctcttttactcctgcgagagaactatcagaagagttcgtgagagcagttatggggtgaccgtcatcaaggtaagcaacatatttcacatgaattgcacgatgagtattttcaatttattctagcttctaagtgtacaagaataccattaattgactatcaaatgtgccatgcaggcagcaatttaccctggaaatgtgctctctattcacatgaataaaccatcaagtttcaagtacaaaagtgggatgtatatgtttgtaaaatgcccagatgtttcgccttttgaatggtaccatctgatcgtctctgtccaaatgtcagtgtttatccaggctatggattaatagattcttcaatgcttccaggcatcccttctccataacttctgcacctggagatgactacttgagtgttcatatccgtacattaggtgactggacaacagaacttagaaacctatttgggaaggtcagttgagcaaacagaaacaaaaagaaaaggagaatagttcaggcataatgggagcttatgcagtatttatatgctaaattaacaaagttgctaaagggttatgctaattcatgcaggcttgtgaggcacaagtaagttccaagaaggctacacttgcacgacttgaaaccactatcatagcagatggtctgaaagaggagacttggtaattatgccctgtttgtttcatattctacattcatctactttttgaaggaatttctatacaattgtttcactaatcttcctgactttggttctcttcatttagctttcccaaagtctttatagatggtcctttcggcgcaccagctcaaaattacaagaaatatgacattcttttgcttatcgggcttggaattggagcaacgcctttcatcagcatactgaaggatctcctgaacaacataaaatccaatggagtaaactgcttaactatagcaaattctttcttatacagtaaaccaagtgcataatatctaaagtgaattggattcaacaggatgtgcaaagcacgcatgatgctgagttaggctgcacctttaagagcaatgggccaggaagagcttatttctactgggtcaccagagagcaaggttcctttgaatggtttaaaggcgtgatgaatgatgttgctgaaagtgatcatgatgtactactcagtctaactgcttcagtgcaacttccatgttctctccttcagattaataaatagatactaacataatcactcactatacagaatgtaatagagatgcacaattacctgacaagcgtgtatgaagaaggagatgcaagatcagctctgattgccatggtccaatcacttcaacatgccaaaaatggtgtggatatcgtctctggcagcaaggtttttcccacttctatcctcctgcaaaaataaaaataaaaactaaatcacatgtgcaaaatttgattcaatatttctcgctttatgcagatccggacacattttgcaaggccgaactggagaaaggtattctcagatctggccaatgcccaccagaactctcgtataggtcagttctatgtgataaatctcaagtgatggttcctagtttacaggatagcaatgctgagatgtttcataaatctgcaggcgttttctactgtgggtctccaacacttacgaaaatgctgagggatctttcactagaattcagccagacgacaacgactcggttccatttccacaaggagaacttctaagaccagaccaggaaaaaaacaccaaaataatcgcaggcgctcttatatagaacaagaaattttagcatcggttagcaactctttctgtgtaaagttccatcaagaactggaacattggtgtacaaaggtacgtgggcattagttagtgctgctgccgtttatagatggaggaaaaagaaaggcatgtattttctgagcaatttgattgtttcttagaatgtactagaaacaacgtgcggctttgccgcgcccaatttagattaggccaatctattttgtcagtggccttgtttaggatcaatggttttttttcttaacatattgaaccaaaaacctaaagaaataaattaatagacgttgggacttg</dnaseqindica> |
| External Link(s) |