Difference between revisions of "Os05g0465800"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Expression)
 
(7 intermediate revisions by the same user not shown)
Line 16: Line 16:
 
decreased activity of NADPH oxidase. Taken together, these data favored the novel conclusion that PI3K regulated NADPH
 
decreased activity of NADPH oxidase. Taken together, these data favored the novel conclusion that PI3K regulated NADPH
 
oxidase activity through modulating the recruitment of Rac-1 to plasma membrane and accelerated the process of rice seed
 
oxidase activity through modulating the recruitment of Rac-1 to plasma membrane and accelerated the process of rice seed
germination
+
germination.
  
 
===Expression===
 
===Expression===
Line 22: Line 22:
 
2+(below10 mM) could further increase the expression of PI3Kin rice seeds after germinated for 12 h. However, when the concentration of Ca2+ was up to 20 mM, thePI3Kexpression began to
 
2+(below10 mM) could further increase the expression of PI3Kin rice seeds after germinated for 12 h. However, when the concentration of Ca2+ was up to 20 mM, thePI3Kexpression began to
 
decrease slightly compared with the treatment with 10 mM
 
decrease slightly compared with the treatment with 10 mM
CaCl2(Figure 1B, D).
+
CaCl2(Figure 1B, D).[[File:1.jpg|right|thumb|275px|'''Figure 1.''' ''.Changes ofPI3Kexpression in rice seed after imbibition...(from reference) <ref name="ref1" />.'']]
LY294002 and Wortmannin inhibit rice seed germination
+
 
Next, Wortmannin and LY294002, two kinds of PI3K
+
LY294002 and Wortmannin inhibit ROS production.To further investigate this relationship between PI3K and ROS,
inhibitors with different action mechanisms, were used to test
 
the role of PI3K in the de-coated (without pericarp) rice seed
 
germination [21]. Following treatment with 60mM LY294002 at
 
27uC for four days, the seed germination rate decreased to about
 
67.3% compared with the control. And it was further decreased to
 
54.0% when the concentration of LY294002 was increased to
 
90mM (Figure 2A). The seed germination rate was 55.7% of the
 
control in the presence of 20mM Wortmannin and it would be
 
decreased to 31.7% of the control with 30mM Wortmannin
 
(Figure 2B). Dynamics of seed germination revealed that, relative
 
to the control, 60 mM LY294002 or 20mM Wortmannin
 
displayed both significant inhibitory effects on the seed germination at any time point (Figure 2C). From these results, we
 
reasonably concluded that PI3K played a positive role in rice seed
 
germination.
 
LY294002 and Wortmannin inhibit ROS production
 
PI3K inhibitors suppressed the ROS production in guard cell,
 
root hair, and pollen tube [18,19,23]. However, it was uncertain
 
that PI3K inhibitors restrained the ROS formation in rice seed
 
germination. In our case, it was found that exogenous hydrogen
 
peroxide (H2O2) could partly rescue the inhibitory effects of PI3K
 
inhibitors on rice seed germination (Figure S1A). This finding
 
allowed us to assume the possible association of PI3K with ROS
 
production during rice seed germination.
 
LY294002 and Wortmannin inhibit ROS production
 
PI3K inhibitors suppressed the ROS production in guard cell,
 
root hair, and pollen tube [18,19,23]. However, it was uncertain
 
that PI3K inhibitors restrained the ROS formation in rice seed
 
germination. In our case, it was found that exogenous hydrogen
 
peroxide (H2O2) could partly rescue the inhibitory effects of PI3K
 
inhibitors on rice seed germination (Figure S1A). This finding
 
allowed us to assume the possible association of PI3K with ROS
 
production during rice seed germination To further investigate this relationship between PI3K and ROS,
 
 
ROS probe H2
 
ROS probe H2
 
DCFDA was used to examine the characteristics of
 
DCFDA was used to examine the characteristics of
 
ROS production under the treatment of pharmacological
 
ROS production under the treatment of pharmacological
inhibitors of PI3K LY294002 (60 mM) or Wortmannin (20mM).
+
inhibitors of PI3K LY294002 (60 mM) or Wortmannin (20mM).[[File:2.jpg|right|thumb|275px|'''Figure 2.''' ''.The effect of PI3K inhibitors LY294002 and Wortmannin on seed germination in rice...(from reference) <ref name="ref1" />.'']]
Results demonstrated that, during the imbibition period of 48 h,
 
treatment with PI3K inhibitors resulted in lower level of ROS
 
production compared with the control (Figure 3A). Meanwhile,
 
the change of superoxide anion was also examined through NBT
 
staining [33] and XTT test [34]. As shown in Figure 3B, 3C, the
 
alteration of superoxide anion was similar with the change of ROS
 
level. Interestingly, PI3K inhibitors seemed to suppress ROS not
 
only by NADPH oxidase but also other sources (Figure S2). The
 
above findings led us to get the conclusion that PI3K inhibitors
 
could suppress the formation of ROS in rice seed germination.
 
NADPH oxidase is an important source of ROS in rice
 
seed germination
 
Several studies have showed that ROS plays a key role in seed
 
germination [7,35,36]. Here, we also found that rice seed
 
germination could be inhibited by ROS scavengers, 10 mM KI
 
or 1 Mm ASA (Figure S1B). Subsequently, 100mM diphenylene
 
iodonium (DPI), one of the highly effective inhibitor of NADPH
 
oxidase [27], was used to explore whether NADPH oxidase is
 
involved in ROS production responsible for rice germination. As
 
shown in Figure S1B, the germination rate in rice seed treated
 
with DPI was lower than that of control. Interestingly, exogenous
 
H2O2 (20 mM) could partly rescue the decrease in seed
 
germination caused not only by KI and ASA but also by DPI
 
(Figure S1B). These phenomenons indicated that NADPH oxidase
 
might be the important source of ROS formation in rice seed
 
embryo under germination.
 
To prove this hypothesis, the concentration of superoxide anion
 
was under determination in the absence and presence of 60mm
 
LY294002 or 20mm Wortmannin. As shown in Figure 4A, NBT
 
was applied to evaluate the quantity of superoxide anion. DPI
 
(100 mM) was added before NBT staining. Compared with
 
control, exogenous DPI could significantly suppress the formation
 
deposits in the embryos.
 
To further verify this phenomenon, superoxide anion was
 
quantified by XTT [34]. As was illustrated in Figure 4B, under the
 
treatment of PI3K inhibitors LY294002 (60 mM) or Wortmannin
 
(20 mM), the formation of superoxide anion was obviously
 
restricted in contrast with control. These observations confirm
 
the idea that NADPH oxidase is an important source of ROS in
 
seed germination.
 
 
LY294002 and Wortmannin inhibit the expression of
 
LY294002 and Wortmannin inhibit the expression of
 
NADPH oxidase
 
NADPH oxidase
Line 107: Line 35:
 
production during rice seed germination. Therefore, it is worth
 
production during rice seed germination. Therefore, it is worth
 
assuming that PI3K might control ROS level via regulating
 
assuming that PI3K might control ROS level via regulating
NADPH oxidase. In the previous study, it has been proved that
+
NADPH oxidase. In the previous study, it has been proved that PI3K is associated with nuclear transcription sites in higher plant.[[File:3.jpg|right|thumb|275px|'''Figure 3.''' ''..PI3K inhibitors LY294002 and Wortmannin suppressed the ROS generation in rice seed embryos during
PI3K is associated with nuclear transcription sites in higher plant
+
germination. .(from reference) <ref name="ref1" />.'']]
[12]. Thus, we examined whether PI3K regulated the transcription of NADPH oxidase in rice seed germination. Firstly, in order
 
to investigate the types of NADPH oxidase in the rice seed
 
germination, the RNA was extracted from wild type rice seed
 
imbibed for 24 h. RT-PCR experiments revealed that NADPH
 
oxidase Os rboh2, Os rboh4, Os rboh5 and Os rboh9 played a
 
primary role in rice seed germination (Figure 5A, B). Besides, the
 
dynamics of these types of NADPH oxidase expression was also assayed during the initial 24 h of rice seed germination (Figure 5C,
 
D). To investigate whether PI3K promote the transcription of
 
NADPH oxidase in the rice seed germination, the expression of
 
NADPH oxidase was examined in the presence of 60mm
 
LY294002 or 20mm Wortmannin. As shown in Figure 5E, F,
 
the PI3K inhibitors notably restrained the expression of NADPH
 
oxidae Osrboh9 and slightly suppressed the expression of Osrboh4
 
in comparison with other types of NADPH oxidase. On the basis
 
of the above results, we drew the conclusion that PI3K could
 
promote the transcription of Osrboh4and Osrboh9 other than the
 
rest types of NADPH oxidase.
 
PI3K is required for subcellular translacaiton of Rac-1
 
In mammalian cells, it has been proved that PI3K class I can
 
regulate the translocation of cytosolic factors, such as Rac-1. In fact,
 
it is necessary for the assembly of the active NADPH oxidase
 
complex to translocate Rac-1 to the cell membrane in rice cells [31].
 
However, it has been unclear whether PI3K regulates NADPH
 
oxidase activity through mediating the translocation of Rac-1. To investigate the possible mechanisms of Rac1 regulated by
 
PI3K, western blot was used. The experiment was performed with
 
total or membrane protein isolated from rice seed embryo cells
 
imbibed for 24 h with or without 60 mM LY294002 or 20mM
 
Wortmannin. Western blot analysis of membrane protein
 
indicated that the translocation of Rac-1, following the treatment
 
of LY294002, was suppressed compared with control, whereas the
 
quantity of Rac-1 from the total protein was not obviously altered.
 
In addition, compared with that of LY294002, another PI3K
 
inhibitor Wortmannin seemed to abate the amount of total Rac1
 
while it reduced the amount of membrane Rac1 severely
 
(Figure 7A, 7B). These results (Figure 7C, 7D) confirmed the
 
speculation that PI3K promoted the translocation of Rac-1 to the
 
membrane and thus facilitated the activity of NADPH oxidase
 
  
 
===Evolution===
 
===Evolution===
 +
PI3K inhibitors suppress the activity of NADPH oxidase.the NADPH oxidase enzymatic activity
 +
was also examined by the measurement of the XTT formazan
 +
concentration with 60mM LY294002 or 20mM Wortmannin.
 +
The experimental result showed that the LY294002 and
 +
Wortmannin inhibited NADPH oxidase activity by 36.6% and
 +
18.2%, respectively.
 +
Together with the above work, the data presented here provided
 +
a comprehensive view of the mechanism of PI3K-dependent seed
 +
germination with ROS as key signaling elements in rice seed
 +
germination. A scheme showing this mechanism was presented in
 +
Figure 8. We proposed that PI3K could promote the translocation
 +
of Rac-1 to membrane, and then elevated the activity of NADPH
 +
oxidase, finally increased the formation of ROS. The elevated ROS
 +
level could trigger carbonylation of proteins and this was specifically
 +
associated with seed germination.
  
Although many papers reported that the seed of PI3K mutant
+
==Labs working on this gene==
showed a reduced germination rate compared with wild type [23],
 
it has rarely been directly assayed so far. In this study, we
 
elaborately characterized the effects of PI3K on the rice seed
 
germination by promoting NADPH oxidase activity. LY294002
 
and Wortmannin, two sorts of PI3K specific inhibitor, obviously
 
inhibited the rice seed germination. Our mainly study here focused
 
on the inhibition of ROS generation (Figure 3) and the
 
relationship between PI3K and NADPH oxidase in seed
 
germination.
 
PI3K activity is closely correlated with rice seed
 
germination
 
In plant cells, the level of PI3P, as the product of PI3K, were
 
relatively low, but turn over rapidly following the alteration of
 
external environment [14]. This character determined that the
 
level of PI3P maybe has more sensitive response to the external
 
stimulation. Thus, we firstly examined the expression of PI3Kin
 
rice seed germination (Figure 1A). From 0 hour to 12 hours, the
 
expression of PI3K almost raised thirty times than initial
 
expression, which obviously indicated the key role of PI3K in
 
rice seed germination. Interestingly, the exogenous Ca
 
2+
 
promoted
 
the expression of PI3K(Figure 1B). As we know, the level of Ca
 
2+
 
rapidly increased following by the uptake of water in the early
 
germination. Here, PI3K seemed to be one of the important relay
 
station of Ca
 
2+
 
signal. In previous publication, it had been
 
reported that Wortmannin and LY294002 inhibited Ca
 
2+
 
oscillation induced by ABA [37], which supported the role of
 
PI3P in ABA-induced Ca
 
2+
 
oscillation. In contrast with the above
 
studies, our results showed that Ca
 
2+
 
promoted the expression of
 
PI3K. Meanwhile, it was reported that PI3K could also raise the
 
levels of intracellular Ca
 
2+
 
[37]. Therefore, we speculated that
 
PI3K and Ca
 
2+
 
seemed to have a feedback regulated relationship.
 
This cycle rapidly altered the total quantities of PI3K and Ca
 
2+
 
,
 
which laid the foundation for fulfilling their functions in the seed
 
germination.
 
  
==Labs working on this gene==
+
MOE Key Laboratory of Laser Life Science and Institute of Laser Life Science, College of Biophotonics, South China Normal University, Guangzhou, China
Please input related labs here.
 
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1">Jian Liu;Jun Zhou;Da Xing
 +
  Phosphatidylinositol 3-Kinase Plays a Vital Role in Regulation of Rice Seed Vigor via Altering NADPH Oxidase Activity
 +
  PLoS ONE, 2012, 7(3): e33817</ref>
  
 
==Structured Information==
 
==Structured Information==
Line 220: Line 78:
 
             Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
             Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
             clade; Ehrhartoideae; Oryzeae; Oryza.
 
             clade; Ehrhartoideae; Oryzeae; Oryza.
|
+
|Jian Liu;Jun Zhou;Da Xing
 +
  Phosphatidylinositol 3-Kinase Plays a Vital Role in Regulation of Rice Seed Vigor via Altering NADPH Oxidase Activity
 +
  PLoS ONE, 2012, 7(3): e33817
 
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
 
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
 
AP = Chromosome 5:22905974..22910867|
 
AP = Chromosome 5:22905974..22910867|

Latest revision as of 08:19, 6 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Phosphatidylinositol 3-kinase (PI3K) has been reported to be important in normal plant growth and stress responses. In this study, it was verified that PI3K played a vital role in rice seed germination through regulating NADPH oxidase activity. Suppression of PI3K activity by inhibitors wortmannin or LY294002 could abate the reactive oxygen species (ROS) formation, which resulted in disturbance to the seed germination. And then, the signal cascades that PI3K promoted the ROS liberation was also evaluated. Diphenylene iodonium (DPI), an NADPH oxidase inhibitor, suppressed most of ROS generation in rice seed germination, which suggested that NADPH oxidase was the main source of ROS in this process. Pharmacological experiment and RT-PCR demonstrated that PI3K promoted the expression of Osrboh9. Moreover, functional analysis by native PAGE and the measurement of the 2, 3-bis-(2-methoxy-4-nitro-5-sulfophenyl)-2H-tetrazo-lium-5- carboxanilide (XTT) formazan concentration both showed that PI3K promoted the activity of NADPH oxidase. Furthermore, the western blot analysis of OsRac-1 demonstrated that the translocation of Rac-1 from cytoplasm to plasma membrane, which was known as a key factor in the assembly of NADPH oxidase, was suppressed by treatment with PI3K inhibitors, resulting in the decreased activity of NADPH oxidase. Taken together, these data favored the novel conclusion that PI3K regulated NADPH oxidase activity through modulating the recruitment of Rac-1 to plasma membrane and accelerated the process of rice seed germination.

Expression

Changes of PI3K expression in rice seed after imbibition and the expression of PI3K is regulated by Ca2+. To determine the dynamic expression ofPI3Kin rice seed germination, the total RNA was extracted from the rice seed embryo after imbibition. The result of RT-PCR analysis suggested that PI3K might involve in the regulation of seed germination. Meanwhile, it was found that the expression ofPI3K was increased with the prolongation of imbibition time (Figure 1A).This expression peaked at 12 h and reached 30 times as many as seeds without treatment (Figure 1C). Interestingly, low concentration of Ca 2+(below10 mM) could further increase the expression of PI3Kin rice seeds after germinated for 12 h. However, when the concentration of Ca2+ was up to 20 mM, thePI3Kexpression began to decrease slightly compared with the treatment with 10 mM

CaCl2(Figure 1B, D).
Figure 1. .Changes ofPI3Kexpression in rice seed after imbibition...(from reference) [1].

LY294002 and Wortmannin inhibit ROS production.To further investigate this relationship between PI3K and ROS, ROS probe H2 DCFDA was used to examine the characteristics of ROS production under the treatment of pharmacological

inhibitors of PI3K LY294002 (60 mM) or Wortmannin (20mM).
Figure 2. .The effect of PI3K inhibitors LY294002 and Wortmannin on seed germination in rice...(from reference) [1].

LY294002 and Wortmannin inhibit the expression of NADPH oxidase The earlier studies have reported that NADPH oxidasegenerated ROS plays a key role in seed germination [7,35,36]. As mentioned above, PI3K inhibitors can prevent ROS production during rice seed germination. Therefore, it is worth assuming that PI3K might control ROS level via regulating

NADPH oxidase. In the previous study, it has been proved that PI3K is associated with nuclear transcription sites in higher plant.
Figure 3. ..PI3K inhibitors LY294002 and Wortmannin suppressed the ROS generation in rice seed embryos during germination. .(from reference) [1].

Evolution

PI3K inhibitors suppress the activity of NADPH oxidase.the NADPH oxidase enzymatic activity was also examined by the measurement of the XTT formazan concentration with 60mM LY294002 or 20mM Wortmannin. The experimental result showed that the LY294002 and Wortmannin inhibited NADPH oxidase activity by 36.6% and 18.2%, respectively. Together with the above work, the data presented here provided a comprehensive view of the mechanism of PI3K-dependent seed germination with ROS as key signaling elements in rice seed germination. A scheme showing this mechanism was presented in Figure 8. We proposed that PI3K could promote the translocation of Rac-1 to membrane, and then elevated the activity of NADPH oxidase, finally increased the formation of ROS. The elevated ROS level could trigger carbonylation of proteins and this was specifically associated with seed germination.

Labs working on this gene

MOE Key Laboratory of Laser Life Science and Institute of Laser Life Science, College of Biophotonics, South China Normal University, Guangzhou, China

References

<references> [1]

Structured Information

Gene Name

Os05g0465800

Description

Similar to RbohAp108

Version

NM_001062318.1 GI:115464366 GeneID:4339045

Length

4894 bp

Definition

Oryza sativa Japonica Group Os05g0465800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

{{{Chromosome}}}

Location

Chromosome 5:22905974..22910867

Sequence Coding Region

22906100..22906400,22907201..22907363,22907440..22907488,22907582..22907695,22907768..22908190
,22908263..22908649,22908733..22908828,22908934..22909049,22909126..22909228
,22909348..22909436,22909542..22909692,22909773..22909922,22910013..22910141
,22910232..22910310,22910391..22910500

Expression

GEO Profiles:Os05g0465800

Genome Context

<gbrowseImage1> name=NC_008398:22905974..22910867 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:22905974..22910867 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgggggactacgtggacgtgccgctgggcggcggcgggcagagcacgctgccgccggtggcgccgctgaagaagcagccgtcgcggctggcgtccgggatgaagcggctggcgtccatggtgcccgacacgatgaagctgaagcggacgcactccagcgcgcagccggcgctgcgcggcctgcgcttcctcgacaagacgtcggcggggaaggacgggtggaagaacgtcgagaagcggttcgacgagatgagcgccgacggacgcctgccccaggagagcttcgccaaatgcatcggtatggcggattctaaggagtttgcaagcgaggtgtttgtggcattggcgagaaggaggagcatcaaaccagaagatgggataacaaaggaacagctgaaagaattttgggaggagttgactgatcagaactttgattcacgactacgaatattctttgacatgtgtgacaagaatggtgatgggcagcttacagaggacgaggtcaaagaggttattgtgttgagtgccgcagcaaacaaacttgccaagttgaaaagccatgctgcaacctacgcctcactgatcatggaagagctggatcctgatcatcgcggttacattgagatttggcagctggagacgctactccgtggtatggtgacagcccaagggcctccagagaaggtgaagctggcttcagcaagccttgcaaggacaatggtcccttccagtcaccggagtccaatgcagaggcgtttcaacaagactgttgacttcatccatgagaattggaagaggatatgggtgctctccttgtgggcgatcctcaatattgcattattcatgtacaagtttgtgcagtacagtaggcgggatgcatttcaggtgatgggctactgtgtctgcatagcaaagggtgctgccgaaacactcaagctgaacatggccgttatactcctcccggtgtgccgaaacacactaacaaggctccgatcaacagcactcagcaaagtcgtaccatttgatgataacataaacttccacaaggttatcgcactgacgattgcaattggagcggctactcatactcttgctcatgtaacctgcgacttcccaagattggtatcatgtccaagggacaagttcgaggccacactggggccttacttcaactatgttcaaccaacatactcatcgctggttgcaagcactccagggtggactggcatcctcatgatcttgataatgtcattctcgttcacacttgcgacacattcgttcaggaggagcgttgtgaagcttccatcaccactgcaccaccttgctggtttcaatgccttttggtacgcccatcacctactggtgattgcatatatcctcttggtgctgcactcctacttcatatttctcaccaagcagtggtacaatcgaacgacgtggatgttcttggcagttccagtcctcttttactcctgcgagagaactatcagaagagttcgtgagagcagttatggggtgaccgtcatcaaggcagcaatttaccctggaaatgtgctctctattcacatgaataaaccatcaagtttcaagtacaaaagtgggatgtatatgtttgtaaaatgcccagatgtttcgccttttgaatggcatcccttctccataacttctgcacctggagatgactacttgagtgttcatatccgtacattaggtgactggacaacagaacttagaaacctatttgggaaggcttgtgaggcacaagtaagttccaagaaggctacacttgcacgacttgaaaccactatcatagcagatggtctgaaagaggagacttgctttcccaaagtctttatagatggtcctttcggcgcaccagctcaaaattacaagaaatatgacattcttttgcttatcgggcttggaattggagcaacgcctttcatcagcatactgaaggatctcctgaacaacataaaatccaatggagatgtgcaaagcacgcatgatgctgagttaggctgcacctttaagagcaatgggccaggaagagcttatttctactgggtcaccagagagcaaggttcctttgaatggtttaaaggcgtgatgaatgatgttgctgaaagtgatcatgataatgtaatagagatgcacaattacctgacaagcgtgtatgaagaaggagatgcaagatcagctctgattgccatggtccaatcacttcaacatgccaaaaatggtgtggatatcgtctctggcagcaagatccggacacattttgcaaggccgaactggagaaaggtattctcagatctggccaatgcccaccagaactctcgtataggcgttttctactgtgggtctccaacacttacgaaaatgctgagggatctttcactagaattcagccagacgacaacgactcggttccatttccacaaggagaacttctaa</cdnaseq>

Protein Sequence

<aaseq>MAGDYVDVPLGGGGQSTLPPVAPLKKQPSRLASGMKRLASMVPD TMKLKRTHSSAQPALRGLRFLDKTSAGKDGWKNVEKRFDEMSADGRLPQESFAKCIGM ADSKEFASEVFVALARRRSIKPEDGITKEQLKEFWEELTDQNFDSRLRIFFDMCDKNG DGQLTEDEVKEVIVLSAAANKLAKLKSHAATYASLIMEELDPDHRGYIEIWQLETLLR GMVTAQGPPEKVKLASASLARTMVPSSHRSPMQRRFNKTVDFIHENWKRIWVLSLWAI LNIALFMYKFVQYSRRDAFQVMGYCVCIAKGAAETLKLNMAVILLPVCRNTLTRLRST ALSKVVPFDDNINFHKVIALTIAIGAATHTLAHVTCDFPRLVSCPRDKFEATLGPYFN YVQPTYSSLVASTPGWTGILMILIMSFSFTLATHSFRRSVVKLPSPLHHLAGFNAFWY AHHLLVIAYILLVLHSYFIFLTKQWYNRTTWMFLAVPVLFYSCERTIRRVRESSYGVT VIKAAIYPGNVLSIHMNKPSSFKYKSGMYMFVKCPDVSPFEWHPFSITSAPGDDYLSV HIRTLGDWTTELRNLFGKACEAQVSSKKATLARLETTIIADGLKEETCFPKVFIDGPF GAPAQNYKKYDILLLIGLGIGATPFISILKDLLNNIKSNGDVQSTHDAELGCTFKSNG PGRAYFYWVTREQGSFEWFKGVMNDVAESDHDNVIEMHNYLTSVYEEGDARSALIAMV QSLQHAKNGVDIVSGSKIRTHFARPNWRKVFSDLANAHQNSRIGVFYCGSPTLTKMLR DLSLEFSQTTTTRFHFHKENF</aaseq>

Gene Sequence

<dnaseqindica>127..427#1228..1390#1467..1515#1609..1722#1795..2217#2290..2676#2760..2855#2961..3076#3153..3255#3375..3463#3569..3719#3800..3949#4040..4168#4259..4337#4418..4527#tttcttcattggcctggaacgacgacgaccacgtacgccatggcgcccggggccacgctcctcctgcggtgagggcacccaccaccaccaccagcagcagcagcgggctacctagttcggatcaggatggcgggggactacgtggacgtgccgctgggcggcggcgggcagagcacgctgccgccggtggcgccgctgaagaagcagccgtcgcggctggcgtccgggatgaagcggctggcgtccatggtgcccgacacgatgaagctgaagcggacgcactccagcgcgcagccggcgctgcgcggcctgcgcttcctcgacaagacgtcggcggggaaggacgggtggaagaacgtcgagaagcggttcgacgagatgagcgccgacggacgcctgccccaggagagcttcgccaaatgcatcggtgagtgctcctgcacatgcccccatggtgttctccatcctccaaagtgattagtgattcaccacagcatgaaaagagagacggtgaaattgcattgttagcaagaacacatcgaaaattgacaagctttgttttccctgcaaaaaaaaaaggggaaaatgttgtcaaagcttttgtgcatgtgatggaaaaaggggaacagttagtagatgagaaattggtacagatcattcctagctcgtatgtcgatggtgtttgtccaaaatttcagccatttcaactgtttaagcagccagcctcctcctgccatccatgcatacatgtttgcagcacttctttgataaagtatacataatcattcctattcacaattttattttaacaaaaaacggaggaaagaaaattggaaaatttaagaggatataattggtcgaccacgggttgcacaaagttcagactttggcccccccaaatataactcggagacaatacttaccacgtagcaagaataggatatacttcctccgtttcataatgtaagactttcaatcattgcccacattcatatagatgttaatgaatctagacatatatatatgtgtatagattcattaacatctatatgaatatgggcaatgctagaaagtcttacaatatgaaacggagggagtactcgtgcttacgacattttcttttaaaagaagtgtagtcaggtaaataaatgacatcagaatagcaataaatccatcctctgtatataaattgaagctctaagcttagaatgcctctgcaacttaaaggtatggcggattctaaggagtttgcaagcgaggtgtttgtggcattggcgagaaggaggagcatcaaaccagaagatgggataacaaaggaacagctgaaagaattttgggaggagttgactgatcagaactttgattcacgactacgaatattctttgacatgtaaaggtctaccttccttgtcttcaatggaaaaaaccttatgacttgccccttgatgagattgctttgcaatcaggtgtgacaagaatggtgatgggcagcttacagaggacgaggtcaaagaggtcagttcccaatcatctctgaatttaccttttttccacaaagcttgtggaaatgatctcaataagaatttacctttctctttccatatgcaggttattgtgttgagtgccgcagcaaacaaacttgccaagttgaaaagccatgctgcaacctacgcctcactgatcatggaagagctggatcctgatcatcgcggttacattgaggtaccaagacatgaaattatctcccttttttttgacaaacagcagcatacagatatgcttgtctcaatgcagatttggcagctggagacgctactccgtggtatggtgacagcccaagggcctccagagaaggtgaagctggcttcagcaagccttgcaaggacaatggtcccttccagtcaccggagtccaatgcagaggcgtttcaacaagactgttgacttcatccatgagaattggaagaggatatgggtgctctccttgtgggcgatcctcaatattgcattattcatgtacaagtttgtgcagtacagtaggcgggatgcatttcaggtgatgggctactgtgtctgcatagcaaagggtgctgccgaaacactcaagctgaacatggccgttatactcctcccggtgtgccgaaacacactaacaaggctccgatcaacagcactcagcaaagtcgtaccatttgatgataacataaacttccacaaggtacacgtgtggaactctttgccatttccaggattacacagcctgacctctttgttctgatcaccatatcaggttatcgcactgacgattgcaattggagcggctactcatactcttgctcatgtaacctgcgacttcccaagattggtatcatgtccaagggacaagttcgaggccacactggggccttacttcaactatgttcaaccaacatactcatcgctggttgcaagcactccagggtggactggcatcctcatgatcttgataatgtcattctcgttcacacttgcgacacattcgttcaggaggagcgttgtgaagcttccatcaccactgcaccaccttgctggtttcaatgccttttggtacgcccatcacctactggtgattgcatatatcctcttggtgctgcactcctacttcatatttctcaccaagcagtggtacaatcgaacggtatttctctggcatatgtttggcacaactatttcttttgtgaattcagtggttgtgcataatattgacgcttgtgtttacagacgtggatgttcttggcagttccagtcctcttttactcctgcgagagaactatcagaagagttcgtgagagcagttatggggtgaccgtcatcaaggtaagcaacatatttcacatgaattgcacgatgagtattttcaatttattctagcttctaagtgtacaagaataccattaattgactatcaaatgtgccatgcaggcagcaatttaccctggaaatgtgctctctattcacatgaataaaccatcaagtttcaagtacaaaagtgggatgtatatgtttgtaaaatgcccagatgtttcgccttttgaatggtaccatctgatcgtctctgtccaaatgtcagtgtttatccaggctatggattaatagattcttcaatgcttccaggcatcccttctccataacttctgcacctggagatgactacttgagtgttcatatccgtacattaggtgactggacaacagaacttagaaacctatttgggaaggtcagttgagcaaacagaaacaaaaagaaaaggagaatagttcaggcataatgggagcttatgcagtatttatatgctaaattaacaaagttgctaaagggttatgctaattcatgcaggcttgtgaggcacaagtaagttccaagaaggctacacttgcacgacttgaaaccactatcatagcagatggtctgaaagaggagacttggtaattatgccctgtttgtttcatattctacattcatctactttttgaaggaatttctatacaattgtttcactaatcttcctgactttggttctcttcatttagctttcccaaagtctttatagatggtcctttcggcgcaccagctcaaaattacaagaaatatgacattcttttgcttatcgggcttggaattggagcaacgcctttcatcagcatactgaaggatctcctgaacaacataaaatccaatggagtaaactgcttaactatagcaaattctttcttatacagtaaaccaagtgcataatatctaaagtgaattggattcaacaggatgtgcaaagcacgcatgatgctgagttaggctgcacctttaagagcaatgggccaggaagagcttatttctactgggtcaccagagagcaaggttcctttgaatggtttaaaggcgtgatgaatgatgttgctgaaagtgatcatgatgtactactcagtctaactgcttcagtgcaacttccatgttctctccttcagattaataaatagatactaacataatcactcactatacagaatgtaatagagatgcacaattacctgacaagcgtgtatgaagaaggagatgcaagatcagctctgattgccatggtccaatcacttcaacatgccaaaaatggtgtggatatcgtctctggcagcaaggtttttcccacttctatcctcctgcaaaaataaaaataaaaactaaatcacatgtgcaaaatttgattcaatatttctcgctttatgcagatccggacacattttgcaaggccgaactggagaaaggtattctcagatctggccaatgcccaccagaactctcgtataggtcagttctatgtgataaatctcaagtgatggttcctagtttacaggatagcaatgctgagatgtttcataaatctgcaggcgttttctactgtgggtctccaacacttacgaaaatgctgagggatctttcactagaattcagccagacgacaacgactcggttccatttccacaaggagaacttctaagaccagaccaggaaaaaaacaccaaaataatcgcaggcgctcttatatagaacaagaaattttagcatcggttagcaactctttctgtgtaaagttccatcaagaactggaacattggtgtacaaaggtacgtgggcattagttagtgctgctgccgtttatagatggaggaaaaagaaaggcatgtattttctgagcaatttgattgtttcttagaatgtactagaaacaacgtgcggctttgccgcgcccaatttagattaggccaatctattttgtcagtggccttgtttaggatcaatggttttttttcttaacatattgaaccaaaaacctaaagaaataaattaatagacgttgggacttg</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0465800, RefSeq:Os05g0465800

  1. 1.0 1.1 1.2 1.3 Jian Liu;Jun Zhou;Da Xing Phosphatidylinositol 3-Kinase Plays a Vital Role in Regulation of Rice Seed Vigor via Altering NADPH Oxidase Activity PLoS ONE, 2012, 7(3): e33817