Difference between revisions of "Os08g0103900"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
 
(5 intermediate revisions by the same user not shown)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
 +
a NAM-like protein gene, Also a gene of NAC family.the last intron and exon of this gene overlaps with the first exon of a BTP/POZ domain-containing protein
 +
(Os08g0103600) gene. RNAi (RNA interference) pathway controls gene Os08g0103900 as well as gene Os08g0103600
 
===Function===
 
===Function===
 
Please input function information here.
 
Please input function information here.
 
+
gene Os08g0103900 ia a gene of the five clades containing rice andArabidopsiscell wall-associated genes,it shown to functionally complement the Arabidopsis snd1/nst1 double mutant with the nother two homologous rice NACs (Os06g0131700 and Os06g0104200).
 
===Expression===
 
===Expression===
 
Please input expression information here.
 
Please input expression information here.
Line 14: Line 16:
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
1 Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan;
 +
 
 +
2 Biological Information Research Center, National Institute of Advanced Industrial Science and Technology, Koto-ku, Tokyo 135-0064, Japan;
 +
 
 +
3 Center for Information Biology and DNA Data Bank of Japan, National Institute of Genetics, Research Organization of Information and Systems, Mishima, Shizuoka 411-8540, Japan;
 +
 
 +
4 Japan Biological Information Research Center, Japan Biological Informatics Consortium, Koto-ku, Tokyo 135-0064, Japan;
 +
 
 +
5 EMBL Outstation–European Bioinformatics Institute, Wellcome Trust Genome Campus, Cambridge CB10 1SD, United Kingdom;
 +
 
 +
6 Biometrics and Bioinformatics Unit, International Rice Research Institute, DAPO Box 7777, Metro Manila, Philippines;
 +
 
 +
7 Department of Biology, McGill University, Montreal, Quebec H3A 1B1, Canada;
 +
 
 +
8 Biology Department, Brookhaven National Laboratory, Upton, New York 11973, USA;
 +
 
 +
9 Department of Genetics, The University of Georgia, Athens, Georgia, 30602-7223, USA;
 +
 
 +
10 Waksman Institute of Microbiology, Rutgers University, Piscataway, New Jersey 08854, USA;
 +
 
 +
11 Institute for Bioinformatics, GSF National Research Center for Environment and Health, D-85764 Neuherberg, Germany;
 +
 
 +
12 Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China;
 +
 
 +
13 Institute of the Society for Techno-innovation of Agriculture, Forestry and Fisheries, Tsukuba, Ibaraki 305-0854, Japan;
 +
 
 +
14 Institute of Botany, Academia Sinica, Nankang, Taipei 11529, Taiwan;
 +
 
 +
15 Tsukuba Division, Mitsubishi Space Software Co., Ltd., Tsukuba, Ibaraki 305-0032, Japan;
 +
 
 +
16 Graduate School of Information Science and Technology, Hokkaido University, Sapporo, Hokkaido 060-0814, Japan;
 +
 
 +
17 Department of Plant Breeding, Cornell University, Ithaca, New York 14853, USA;
 +
 
 +
18 Department of Biological Sciences, Tokyo Metropolitan University, Hachioji-shi, Tokyo 192-0397, Japan;
 +
 
 +
19 Department of Plant Molecular Biology, University of Delhi South Campus, New Delhi 110021, India;
 +
 
 +
20 National Institute of Crop Science, National Agriculture and Food Research Organization, Tsukuba, Ibaraki 305-8518, Japan;
 +
 
 +
21 SWISS-PROT Group, Swiss Institute of Bioinformatics, CH-1211 Geneva 4, Switzerland;
 +
 
 +
22 Cold Spring Harbor Laboratory, Cold Spring Harbor, New York 11723, USA;
 +
 
 +
23 Division of Biology, California Institute of Technology, Pasadena, California 91125, USA;
 +
 
 +
24 Institute of Molecular Evolutionary Genetics and Department of Biology, The Pennsylvania State University, University Park, Pennsylvania 16802, USA;
 +
 
 +
25 RIKEN BioResource Center, RIKEN Tsukuba Institute, Tsukuba, Ibaraki 305-0074, Japan;
 +
 
 +
26 Department of Molecular Genetics and Microbiology, and Center for Infectious Diseases, The State University of New York at Stony Brook, Stony Brook, New York
 +
11794, USA;
 +
 
 +
27 Genoscope, 91057 Evry Cedex, France;
 +
 
 +
28 Metabolomics Research Group, RIKEN Plant Science Center, Yokohama, Kanagawa 230-0045, Japan;
 +
 
 +
29 Technische Universität München, Genome Oriented Bioinformatics, D-85354 Freising-Weihenstephan, Germany;
 +
 
 +
30 Plant Computational Biology, Max-Planck-Institute for Plant Breeding Research, D 50829 Cologne, Germany;
 +
 
 +
31 Plant Functional Genomics Research Group, RIKEN Plant Science Center, Yokohama, Kanagawa 230-0045, Japan;
 +
 
 +
32 RIKEN Plant Science Center, Yokohama, Kanagawa 230-0045, Japan;
 +
 
 +
33 National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute, New Delhi 110012, India;
 +
 
 +
34 National Center for Biotechnology Information, National Institutes of Health, Bethesda, Maryland 20894, USA;
 +
 
 +
35 Rice Gene Discovery Unit, Kasetsart University, Nakorn Pathom 73140, Thailand;
 +
 
 +
36 The Institute for Genomic Research, Rockville, Maryland 20850, USA;
 +
 
 +
37 Arizona Genomics Institute, The University of Arizona, Tucson, Arizona 85721, USA;
 +
 
 +
38 National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan;
 +
 
 +
39 Bio-Oriented Technology Research Advancement Institution, Minato-ku, Tokyo 105-0001, Japan.
  
 
==References==
 
==References==
Please input cited references here.
+
[1] "Oryza sativa nipponbare(GA3) genomic DNA, chromosome 8, PAC clone:P0015C07."Sasaki T., Matsumoto T., Yamamoto K.Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
 +
 
 +
[2] "Collection, Mapping, and Annotation of Over 28,000 cDNA Clones from japonica Rice."Kikuchi S., Satoh K., Nagata T., Kawagashira N. Science 301:376-379(2003)
 +
 
 +
[3] "The map-based sequence of the rice genome."International rice genome sequencing project (IRGSP) Nature 436:793-800(2005)
 +
 
 +
[4] "The map-based sequence of the rice genome."International Rice Genome Sequencing Project Matsumoto T., Wu J., Kanamori H., Katayose Y., Fujisawa M.Nature 436:793-800(2005)
 +
 
 +
[5] "The Rice Annotation Project Database (RAP-DB): 2008 update."The Rice Annotation Project (RAP)Tanaka T., Antonio B.A., Kikuchi S., Matsumoto T. Nucleic Acids Res. 36:D1028-D1033(2008)
 +
 
 +
[6] "The rice annotation project database (RAP-DB): 2008 update."The rice annotation project (RAP) Nucleic Acids Res. 36:D1028-D1033(2008) [7] "Transcriptional Activation of Secondary Wall Biosynthesis by Rice and Maize NAC and MYB Transcription Factors."Zhong R., Lee C., McCarthy R.L., Reeves C.K.
  
 
==Structured Information==
 
==Structured Information==

Latest revision as of 08:51, 6 June 2014

Please input one-sentence summary here.

Annotated Information

a NAM-like protein gene, Also a gene of NAC family.the last intron and exon of this gene overlaps with the first exon of a BTP/POZ domain-containing protein (Os08g0103600) gene. RNAi (RNA interference) pathway controls gene Os08g0103900 as well as gene Os08g0103600

Function

Please input function information here. gene Os08g0103900 ia a gene of the five clades containing rice andArabidopsiscell wall-associated genes,it shown to functionally complement the Arabidopsis snd1/nst1 double mutant with the nother two homologous rice NACs (Os06g0131700 and Os06g0104200).

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

1 Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan;

2 Biological Information Research Center, National Institute of Advanced Industrial Science and Technology, Koto-ku, Tokyo 135-0064, Japan;

3 Center for Information Biology and DNA Data Bank of Japan, National Institute of Genetics, Research Organization of Information and Systems, Mishima, Shizuoka 411-8540, Japan;

4 Japan Biological Information Research Center, Japan Biological Informatics Consortium, Koto-ku, Tokyo 135-0064, Japan;

5 EMBL Outstation–European Bioinformatics Institute, Wellcome Trust Genome Campus, Cambridge CB10 1SD, United Kingdom;

6 Biometrics and Bioinformatics Unit, International Rice Research Institute, DAPO Box 7777, Metro Manila, Philippines;

7 Department of Biology, McGill University, Montreal, Quebec H3A 1B1, Canada;

8 Biology Department, Brookhaven National Laboratory, Upton, New York 11973, USA;

9 Department of Genetics, The University of Georgia, Athens, Georgia, 30602-7223, USA;

10 Waksman Institute of Microbiology, Rutgers University, Piscataway, New Jersey 08854, USA;

11 Institute for Bioinformatics, GSF National Research Center for Environment and Health, D-85764 Neuherberg, Germany;

12 Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China;

13 Institute of the Society for Techno-innovation of Agriculture, Forestry and Fisheries, Tsukuba, Ibaraki 305-0854, Japan;

14 Institute of Botany, Academia Sinica, Nankang, Taipei 11529, Taiwan;

15 Tsukuba Division, Mitsubishi Space Software Co., Ltd., Tsukuba, Ibaraki 305-0032, Japan;

16 Graduate School of Information Science and Technology, Hokkaido University, Sapporo, Hokkaido 060-0814, Japan;

17 Department of Plant Breeding, Cornell University, Ithaca, New York 14853, USA;

18 Department of Biological Sciences, Tokyo Metropolitan University, Hachioji-shi, Tokyo 192-0397, Japan;

19 Department of Plant Molecular Biology, University of Delhi South Campus, New Delhi 110021, India;

20 National Institute of Crop Science, National Agriculture and Food Research Organization, Tsukuba, Ibaraki 305-8518, Japan;

21 SWISS-PROT Group, Swiss Institute of Bioinformatics, CH-1211 Geneva 4, Switzerland;

22 Cold Spring Harbor Laboratory, Cold Spring Harbor, New York 11723, USA;

23 Division of Biology, California Institute of Technology, Pasadena, California 91125, USA;

24 Institute of Molecular Evolutionary Genetics and Department of Biology, The Pennsylvania State University, University Park, Pennsylvania 16802, USA;

25 RIKEN BioResource Center, RIKEN Tsukuba Institute, Tsukuba, Ibaraki 305-0074, Japan;

26 Department of Molecular Genetics and Microbiology, and Center for Infectious Diseases, The State University of New York at Stony Brook, Stony Brook, New York 11794, USA;

27 Genoscope, 91057 Evry Cedex, France;

28 Metabolomics Research Group, RIKEN Plant Science Center, Yokohama, Kanagawa 230-0045, Japan;

29 Technische Universität München, Genome Oriented Bioinformatics, D-85354 Freising-Weihenstephan, Germany;

30 Plant Computational Biology, Max-Planck-Institute for Plant Breeding Research, D 50829 Cologne, Germany;

31 Plant Functional Genomics Research Group, RIKEN Plant Science Center, Yokohama, Kanagawa 230-0045, Japan;

32 RIKEN Plant Science Center, Yokohama, Kanagawa 230-0045, Japan;

33 National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute, New Delhi 110012, India;

34 National Center for Biotechnology Information, National Institutes of Health, Bethesda, Maryland 20894, USA;

35 Rice Gene Discovery Unit, Kasetsart University, Nakorn Pathom 73140, Thailand;

36 The Institute for Genomic Research, Rockville, Maryland 20850, USA;

37 Arizona Genomics Institute, The University of Arizona, Tucson, Arizona 85721, USA;

38 National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan;

39 Bio-Oriented Technology Research Advancement Institution, Minato-ku, Tokyo 105-0001, Japan.

References

[1] "Oryza sativa nipponbare(GA3) genomic DNA, chromosome 8, PAC clone:P0015C07."Sasaki T., Matsumoto T., Yamamoto K.Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases

[2] "Collection, Mapping, and Annotation of Over 28,000 cDNA Clones from japonica Rice."Kikuchi S., Satoh K., Nagata T., Kawagashira N. Science 301:376-379(2003)

[3] "The map-based sequence of the rice genome."International rice genome sequencing project (IRGSP) Nature 436:793-800(2005)

[4] "The map-based sequence of the rice genome."International Rice Genome Sequencing Project Matsumoto T., Wu J., Kanamori H., Katayose Y., Fujisawa M.Nature 436:793-800(2005)

[5] "The Rice Annotation Project Database (RAP-DB): 2008 update."The Rice Annotation Project (RAP)Tanaka T., Antonio B.A., Kikuchi S., Matsumoto T. Nucleic Acids Res. 36:D1028-D1033(2008)

[6] "The rice annotation project database (RAP-DB): 2008 update."The rice annotation project (RAP) Nucleic Acids Res. 36:D1028-D1033(2008) [7] "Transcriptional Activation of Secondary Wall Biosynthesis by Rice and Maize NAC and MYB Transcription Factors."Zhong R., Lee C., McCarthy R.L., Reeves C.K.

Structured Information

Gene Name

Os08g0103900

Description

Similar to NAM-like protein

Version

NM_001067310.1 GI:115474356 GeneID:4344435

Length

1990 bp

Definition

Oryza sativa Japonica Group Os08g0103900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:209422..211411

Sequence Coding Region

209881..210386,210500..210787,210912..211092

Expression

GEO Profiles:Os08g0103900

Genome Context

<gbrowseImage1> name=NC_008401:209422..211411 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:209422..211411 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggatcggcatgaggaggaggcaggagagtctccatgtgtgccgccggggttcaggtttcacccgacggaggaggagctggtgggctactacctcgccaggaaggtggcctcccagaagatcgatctcgacatcatccaggagctcgatctctacaggatcgagccatgggatctgcaagagcgttgcaagtacggtgggcatggcggcgatgagcagacggagtggtacttcttcagctacaaggaccgcaagtaccccagcgggacgaggaccaaccgcgccacggcggcgggcttctggaaggccaccggccgcgacaagccggtgctctcgtcgccgtcgacgagggtgatcgggatgaggaagacgctggtgttctacaagggtcgcgcccccaacggccggaagaccgactggatcatccacgagtaccgcctccaatcaaacgaacacgcccctactcaggaggaaggttgggtggtttgccgcgcgtttcagaagccgatgcccaaccagcagcagcacaggctgtcctacggctgcatccccggcagctacggcgccggagcctacgccgccgtccccgacaactacagcttgctgctgcaccacgacaaccctagcttcgccgggcggccattgatgagcgccgctgcctcagctctcttcgccaacaacaacaataacagcgtcgtcgaccacagcaacattctgagttcagagtccaagcttcacttctccgacatgatgccgcctctggagagccccaccatcgtcgacggcgagggctacgtctcgcaggctagcagctgcgtcgacgtcgatcagcaagccggcatcgtcgactggaacctgctcaccagcttgctgccgccgccggcgcatcagctcttccaccacctgccttccgcttctagctccaagaacagcaacaacatttcttcgtcaggcttcatcgatgaccgagactga</cdnaseq>

Protein Sequence

<aaseq>MDRHEEEAGESPCVPPGFRFHPTEEELVGYYLARKVASQKIDLD IIQELDLYRIEPWDLQERCKYGGHGGDEQTEWYFFSYKDRKYPSGTRTNRATAAGFWK ATGRDKPVLSSPSTRVIGMRKTLVFYKGRAPNGRKTDWIIHEYRLQSNEHAPTQEEGW VVCRAFQKPMPNQQQHRLSYGCIPGSYGAGAYAAVPDNYSLLLHHDNPSFAGRPLMSA AASALFANNNNNSVVDHSNILSSESKLHFSDMMPPLESPTIVDGEGYVSQASSCVDVD QQAGIVDWNLLTSLLPPPAHQLFHHLPSASSSKNSNNISSSGFIDDRD</aaseq>

Gene Sequence

<dnaseqindica>1026..1531#625..912#320..500#atccagatgcgcttgcacttgcacttgcatgcagttcattgctctagctataggctatagctactatacactcatgagaatctgagattgggctgaaaattgatgagcatcgatctgaagaagacatatatatagctgatgatgatatagctttttctgcatatgcttgttttgatctgcagccaatcgatcgaggcatagagagtcaccaggcaatcaaattccaaccatccatcagctagatatatatacagcaaagatcacgatactcctagctagctagctagaagaattgatcggtcgatcggaggaaatagcaatggatcggcatgaggaggaggcaggagagtctccatgtgtgccgccggggttcaggtttcacccgacggaggaggagctggtgggctactacctcgccaggaaggtggcctcccagaagatcgatctcgacatcatccaggagctcgatctctacaggatcgagccatgggatctgcaaggtacgtactgatccattacattaaataaaccatgcattctattcatgcataattaatatcaattcagcaattaatttgggaactgaacgatcgatgattctgatgaattatatatatgtggcagagcgttgcaagtacggtgggcatggcggcgatgagcagacggagtggtacttcttcagctacaaggaccgcaagtaccccagcgggacgaggaccaaccgcgccacggcggcgggcttctggaaggccaccggccgcgacaagccggtgctctcgtcgccgtcgacgagggtgatcgggatgaggaagacgctggtgttctacaagggtcgcgcccccaacggccggaagaccgactggatcatccacgagtaccgcctccaatcaaacgaacacgcccctactcaggcatgcattgcaaccacctattccattccatcttaattttttacttctttacttaattatctgtcctactatatatgttaattcatggatattaatatggaatatggatgcaggaggaaggttgggtggtttgccgcgcgtttcagaagccgatgcccaaccagcagcagcacaggctgtcctacggctgcatccccggcagctacggcgccggagcctacgccgccgtccccgacaactacagcttgctgctgcaccacgacaaccctagcttcgccgggcggccattgatgagcgccgctgcctcagctctcttcgccaacaacaacaataacagcgtcgtcgaccacagcaacattctgagttcagagtccaagcttcacttctccgacatgatgccgcctctggagagccccaccatcgtcgacggcgagggctacgtctcgcaggctagcagctgcgtcgacgtcgatcagcaagccggcatcgtcgactggaacctgctcaccagcttgctgccgccgccggcgcatcagctcttccaccacctgccttccgcttctagctccaagaacagcaacaacatttcttcgtcaggcttcatcgatgaccgagactgatcgatcgatccagatcgattattatcaattgacaattcattcatcatatatatgcatgaattcttacaaatacgcacaattaaacgatcgagtgtactattaattagttgattactccgtctccatgatgtatacattaatttgaccactggccatcatcaggccatctgcatgcttactatctagcttatgtcagtacacggttgttagttcattcttaattaattagctactagtgtcagtgtgtgtatctatcggttgttcgtcttttgacctcattgctgagagaggtttgtaactgatgatgattaagttagctagcatttaattaggtgctatatatacacatatatatgcactatcactatatacatcatatatatgtatacatatatcgttgtctgcttaatgtgtacaccacctctctgcagtatatatagtattgatcaattaatttgt</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0103900, RefSeq:Os08g0103900