Difference between revisions of "Os08g0103900"
(→References) |
(→Labs working on this gene) |
||
| (3 intermediate revisions by the same user not shown) | |||
| Line 2: | Line 2: | ||
==Annotated Information== | ==Annotated Information== | ||
| − | a NAM-like protein gene | + | a NAM-like protein gene, Also a gene of NAC family.the last intron and exon of this gene overlaps with the first exon of a BTP/POZ domain-containing protein |
| + | (Os08g0103600) gene. RNAi (RNA interference) pathway controls gene Os08g0103900 as well as gene Os08g0103600 | ||
===Function=== | ===Function=== | ||
Please input function information here. | Please input function information here. | ||
| − | + | gene Os08g0103900 ia a gene of the five clades containing rice andArabidopsiscell wall-associated genes,it shown to functionally complement the Arabidopsis snd1/nst1 double mutant with the nother two homologous rice NACs (Os06g0131700 and Os06g0104200). | |
===Expression=== | ===Expression=== | ||
Please input expression information here. | Please input expression information here. | ||
| Line 13: | Line 14: | ||
You can also add sub-section(s) at will. | You can also add sub-section(s) at will. | ||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | 1 Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan; | |
| + | |||
| + | 2 Biological Information Research Center, National Institute of Advanced Industrial Science and Technology, Koto-ku, Tokyo 135-0064, Japan; | ||
| + | |||
| + | 3 Center for Information Biology and DNA Data Bank of Japan, National Institute of Genetics, Research Organization of Information and Systems, Mishima, Shizuoka 411-8540, Japan; | ||
| + | |||
| + | 4 Japan Biological Information Research Center, Japan Biological Informatics Consortium, Koto-ku, Tokyo 135-0064, Japan; | ||
| + | |||
| + | 5 EMBL Outstation–European Bioinformatics Institute, Wellcome Trust Genome Campus, Cambridge CB10 1SD, United Kingdom; | ||
| + | |||
| + | 6 Biometrics and Bioinformatics Unit, International Rice Research Institute, DAPO Box 7777, Metro Manila, Philippines; | ||
| + | |||
| + | 7 Department of Biology, McGill University, Montreal, Quebec H3A 1B1, Canada; | ||
| + | |||
| + | 8 Biology Department, Brookhaven National Laboratory, Upton, New York 11973, USA; | ||
| + | |||
| + | 9 Department of Genetics, The University of Georgia, Athens, Georgia, 30602-7223, USA; | ||
| + | |||
| + | 10 Waksman Institute of Microbiology, Rutgers University, Piscataway, New Jersey 08854, USA; | ||
| + | |||
| + | 11 Institute for Bioinformatics, GSF National Research Center for Environment and Health, D-85764 Neuherberg, Germany; | ||
| + | |||
| + | 12 Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China; | ||
| + | |||
| + | 13 Institute of the Society for Techno-innovation of Agriculture, Forestry and Fisheries, Tsukuba, Ibaraki 305-0854, Japan; | ||
| + | |||
| + | 14 Institute of Botany, Academia Sinica, Nankang, Taipei 11529, Taiwan; | ||
| + | |||
| + | 15 Tsukuba Division, Mitsubishi Space Software Co., Ltd., Tsukuba, Ibaraki 305-0032, Japan; | ||
| + | |||
| + | 16 Graduate School of Information Science and Technology, Hokkaido University, Sapporo, Hokkaido 060-0814, Japan; | ||
| + | |||
| + | 17 Department of Plant Breeding, Cornell University, Ithaca, New York 14853, USA; | ||
| + | |||
| + | 18 Department of Biological Sciences, Tokyo Metropolitan University, Hachioji-shi, Tokyo 192-0397, Japan; | ||
| + | |||
| + | 19 Department of Plant Molecular Biology, University of Delhi South Campus, New Delhi 110021, India; | ||
| + | |||
| + | 20 National Institute of Crop Science, National Agriculture and Food Research Organization, Tsukuba, Ibaraki 305-8518, Japan; | ||
| + | |||
| + | 21 SWISS-PROT Group, Swiss Institute of Bioinformatics, CH-1211 Geneva 4, Switzerland; | ||
| + | |||
| + | 22 Cold Spring Harbor Laboratory, Cold Spring Harbor, New York 11723, USA; | ||
| + | |||
| + | 23 Division of Biology, California Institute of Technology, Pasadena, California 91125, USA; | ||
| + | |||
| + | 24 Institute of Molecular Evolutionary Genetics and Department of Biology, The Pennsylvania State University, University Park, Pennsylvania 16802, USA; | ||
| + | |||
| + | 25 RIKEN BioResource Center, RIKEN Tsukuba Institute, Tsukuba, Ibaraki 305-0074, Japan; | ||
| + | |||
| + | 26 Department of Molecular Genetics and Microbiology, and Center for Infectious Diseases, The State University of New York at Stony Brook, Stony Brook, New York | ||
| + | 11794, USA; | ||
| + | |||
| + | 27 Genoscope, 91057 Evry Cedex, France; | ||
| + | |||
| + | 28 Metabolomics Research Group, RIKEN Plant Science Center, Yokohama, Kanagawa 230-0045, Japan; | ||
| + | |||
| + | 29 Technische Universität München, Genome Oriented Bioinformatics, D-85354 Freising-Weihenstephan, Germany; | ||
| + | |||
| + | 30 Plant Computational Biology, Max-Planck-Institute for Plant Breeding Research, D 50829 Cologne, Germany; | ||
| + | |||
| + | 31 Plant Functional Genomics Research Group, RIKEN Plant Science Center, Yokohama, Kanagawa 230-0045, Japan; | ||
| + | |||
| + | 32 RIKEN Plant Science Center, Yokohama, Kanagawa 230-0045, Japan; | ||
| + | |||
| + | 33 National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute, New Delhi 110012, India; | ||
| + | |||
| + | 34 National Center for Biotechnology Information, National Institutes of Health, Bethesda, Maryland 20894, USA; | ||
| + | |||
| + | 35 Rice Gene Discovery Unit, Kasetsart University, Nakorn Pathom 73140, Thailand; | ||
| + | |||
| + | 36 The Institute for Genomic Research, Rockville, Maryland 20850, USA; | ||
| + | |||
| + | 37 Arizona Genomics Institute, The University of Arizona, Tucson, Arizona 85721, USA; | ||
| + | |||
| + | 38 National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan; | ||
| + | |||
| + | 39 Bio-Oriented Technology Research Advancement Institution, Minato-ku, Tokyo 105-0001, Japan. | ||
==References== | ==References== | ||
Latest revision as of 08:51, 6 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
a NAM-like protein gene, Also a gene of NAC family.the last intron and exon of this gene overlaps with the first exon of a BTP/POZ domain-containing protein (Os08g0103600) gene. RNAi (RNA interference) pathway controls gene Os08g0103900 as well as gene Os08g0103600
Function
Please input function information here. gene Os08g0103900 ia a gene of the five clades containing rice andArabidopsiscell wall-associated genes,it shown to functionally complement the Arabidopsis snd1/nst1 double mutant with the nother two homologous rice NACs (Os06g0131700 and Os06g0104200).
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
1 Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan;
2 Biological Information Research Center, National Institute of Advanced Industrial Science and Technology, Koto-ku, Tokyo 135-0064, Japan;
3 Center for Information Biology and DNA Data Bank of Japan, National Institute of Genetics, Research Organization of Information and Systems, Mishima, Shizuoka 411-8540, Japan;
4 Japan Biological Information Research Center, Japan Biological Informatics Consortium, Koto-ku, Tokyo 135-0064, Japan;
5 EMBL Outstation–European Bioinformatics Institute, Wellcome Trust Genome Campus, Cambridge CB10 1SD, United Kingdom;
6 Biometrics and Bioinformatics Unit, International Rice Research Institute, DAPO Box 7777, Metro Manila, Philippines;
7 Department of Biology, McGill University, Montreal, Quebec H3A 1B1, Canada;
8 Biology Department, Brookhaven National Laboratory, Upton, New York 11973, USA;
9 Department of Genetics, The University of Georgia, Athens, Georgia, 30602-7223, USA;
10 Waksman Institute of Microbiology, Rutgers University, Piscataway, New Jersey 08854, USA;
11 Institute for Bioinformatics, GSF National Research Center for Environment and Health, D-85764 Neuherberg, Germany;
12 Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China;
13 Institute of the Society for Techno-innovation of Agriculture, Forestry and Fisheries, Tsukuba, Ibaraki 305-0854, Japan;
14 Institute of Botany, Academia Sinica, Nankang, Taipei 11529, Taiwan;
15 Tsukuba Division, Mitsubishi Space Software Co., Ltd., Tsukuba, Ibaraki 305-0032, Japan;
16 Graduate School of Information Science and Technology, Hokkaido University, Sapporo, Hokkaido 060-0814, Japan;
17 Department of Plant Breeding, Cornell University, Ithaca, New York 14853, USA;
18 Department of Biological Sciences, Tokyo Metropolitan University, Hachioji-shi, Tokyo 192-0397, Japan;
19 Department of Plant Molecular Biology, University of Delhi South Campus, New Delhi 110021, India;
20 National Institute of Crop Science, National Agriculture and Food Research Organization, Tsukuba, Ibaraki 305-8518, Japan;
21 SWISS-PROT Group, Swiss Institute of Bioinformatics, CH-1211 Geneva 4, Switzerland;
22 Cold Spring Harbor Laboratory, Cold Spring Harbor, New York 11723, USA;
23 Division of Biology, California Institute of Technology, Pasadena, California 91125, USA;
24 Institute of Molecular Evolutionary Genetics and Department of Biology, The Pennsylvania State University, University Park, Pennsylvania 16802, USA;
25 RIKEN BioResource Center, RIKEN Tsukuba Institute, Tsukuba, Ibaraki 305-0074, Japan;
26 Department of Molecular Genetics and Microbiology, and Center for Infectious Diseases, The State University of New York at Stony Brook, Stony Brook, New York 11794, USA;
27 Genoscope, 91057 Evry Cedex, France;
28 Metabolomics Research Group, RIKEN Plant Science Center, Yokohama, Kanagawa 230-0045, Japan;
29 Technische Universität München, Genome Oriented Bioinformatics, D-85354 Freising-Weihenstephan, Germany;
30 Plant Computational Biology, Max-Planck-Institute for Plant Breeding Research, D 50829 Cologne, Germany;
31 Plant Functional Genomics Research Group, RIKEN Plant Science Center, Yokohama, Kanagawa 230-0045, Japan;
32 RIKEN Plant Science Center, Yokohama, Kanagawa 230-0045, Japan;
33 National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute, New Delhi 110012, India;
34 National Center for Biotechnology Information, National Institutes of Health, Bethesda, Maryland 20894, USA;
35 Rice Gene Discovery Unit, Kasetsart University, Nakorn Pathom 73140, Thailand;
36 The Institute for Genomic Research, Rockville, Maryland 20850, USA;
37 Arizona Genomics Institute, The University of Arizona, Tucson, Arizona 85721, USA;
38 National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan;
39 Bio-Oriented Technology Research Advancement Institution, Minato-ku, Tokyo 105-0001, Japan.
References
[1] "Oryza sativa nipponbare(GA3) genomic DNA, chromosome 8, PAC clone:P0015C07."Sasaki T., Matsumoto T., Yamamoto K.Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
[2] "Collection, Mapping, and Annotation of Over 28,000 cDNA Clones from japonica Rice."Kikuchi S., Satoh K., Nagata T., Kawagashira N. Science 301:376-379(2003)
[3] "The map-based sequence of the rice genome."International rice genome sequencing project (IRGSP) Nature 436:793-800(2005)
[4] "The map-based sequence of the rice genome."International Rice Genome Sequencing Project Matsumoto T., Wu J., Kanamori H., Katayose Y., Fujisawa M.Nature 436:793-800(2005)
[5] "The Rice Annotation Project Database (RAP-DB): 2008 update."The Rice Annotation Project (RAP)Tanaka T., Antonio B.A., Kikuchi S., Matsumoto T. Nucleic Acids Res. 36:D1028-D1033(2008)
[6] "The rice annotation project database (RAP-DB): 2008 update."The rice annotation project (RAP) Nucleic Acids Res. 36:D1028-D1033(2008) [7] "Transcriptional Activation of Secondary Wall Biosynthesis by Rice and Maize NAC and MYB Transcription Factors."Zhong R., Lee C., McCarthy R.L., Reeves C.K.
Structured Information
| Gene Name |
Os08g0103900 |
|---|---|
| Description |
Similar to NAM-like protein |
| Version |
NM_001067310.1 GI:115474356 GeneID:4344435 |
| Length |
1990 bp |
| Definition |
Oryza sativa Japonica Group Os08g0103900, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 8:209422..211411 |
| Sequence Coding Region |
209881..210386,210500..210787,210912..211092 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008401:209422..211411 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008401:209422..211411 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggatcggcatgaggaggaggcaggagagtctccatgtgtgccgccggggttcaggtttcacccgacggaggaggagctggtgggctactacctcgccaggaaggtggcctcccagaagatcgatctcgacatcatccaggagctcgatctctacaggatcgagccatgggatctgcaagagcgttgcaagtacggtgggcatggcggcgatgagcagacggagtggtacttcttcagctacaaggaccgcaagtaccccagcgggacgaggaccaaccgcgccacggcggcgggcttctggaaggccaccggccgcgacaagccggtgctctcgtcgccgtcgacgagggtgatcgggatgaggaagacgctggtgttctacaagggtcgcgcccccaacggccggaagaccgactggatcatccacgagtaccgcctccaatcaaacgaacacgcccctactcaggaggaaggttgggtggtttgccgcgcgtttcagaagccgatgcccaaccagcagcagcacaggctgtcctacggctgcatccccggcagctacggcgccggagcctacgccgccgtccccgacaactacagcttgctgctgcaccacgacaaccctagcttcgccgggcggccattgatgagcgccgctgcctcagctctcttcgccaacaacaacaataacagcgtcgtcgaccacagcaacattctgagttcagagtccaagcttcacttctccgacatgatgccgcctctggagagccccaccatcgtcgacggcgagggctacgtctcgcaggctagcagctgcgtcgacgtcgatcagcaagccggcatcgtcgactggaacctgctcaccagcttgctgccgccgccggcgcatcagctcttccaccacctgccttccgcttctagctccaagaacagcaacaacatttcttcgtcaggcttcatcgatgaccgagactga</cdnaseq> |
| Protein Sequence |
<aaseq>MDRHEEEAGESPCVPPGFRFHPTEEELVGYYLARKVASQKIDLD IIQELDLYRIEPWDLQERCKYGGHGGDEQTEWYFFSYKDRKYPSGTRTNRATAAGFWK ATGRDKPVLSSPSTRVIGMRKTLVFYKGRAPNGRKTDWIIHEYRLQSNEHAPTQEEGW VVCRAFQKPMPNQQQHRLSYGCIPGSYGAGAYAAVPDNYSLLLHHDNPSFAGRPLMSA AASALFANNNNNSVVDHSNILSSESKLHFSDMMPPLESPTIVDGEGYVSQASSCVDVD QQAGIVDWNLLTSLLPPPAHQLFHHLPSASSSKNSNNISSSGFIDDRD</aaseq> |
| Gene Sequence |
<dnaseqindica>1026..1531#625..912#320..500#atccagatgcgcttgcacttgcacttgcatgcagttcattgctctagctataggctatagctactatacactcatgagaatctgagattgggctgaaaattgatgagcatcgatctgaagaagacatatatatagctgatgatgatatagctttttctgcatatgcttgttttgatctgcagccaatcgatcgaggcatagagagtcaccaggcaatcaaattccaaccatccatcagctagatatatatacagcaaagatcacgatactcctagctagctagctagaagaattgatcggtcgatcggaggaaatagcaatggatcggcatgaggaggaggcaggagagtctccatgtgtgccgccggggttcaggtttcacccgacggaggaggagctggtgggctactacctcgccaggaaggtggcctcccagaagatcgatctcgacatcatccaggagctcgatctctacaggatcgagccatgggatctgcaaggtacgtactgatccattacattaaataaaccatgcattctattcatgcataattaatatcaattcagcaattaatttgggaactgaacgatcgatgattctgatgaattatatatatgtggcagagcgttgcaagtacggtgggcatggcggcgatgagcagacggagtggtacttcttcagctacaaggaccgcaagtaccccagcgggacgaggaccaaccgcgccacggcggcgggcttctggaaggccaccggccgcgacaagccggtgctctcgtcgccgtcgacgagggtgatcgggatgaggaagacgctggtgttctacaagggtcgcgcccccaacggccggaagaccgactggatcatccacgagtaccgcctccaatcaaacgaacacgcccctactcaggcatgcattgcaaccacctattccattccatcttaattttttacttctttacttaattatctgtcctactatatatgttaattcatggatattaatatggaatatggatgcaggaggaaggttgggtggtttgccgcgcgtttcagaagccgatgcccaaccagcagcagcacaggctgtcctacggctgcatccccggcagctacggcgccggagcctacgccgccgtccccgacaactacagcttgctgctgcaccacgacaaccctagcttcgccgggcggccattgatgagcgccgctgcctcagctctcttcgccaacaacaacaataacagcgtcgtcgaccacagcaacattctgagttcagagtccaagcttcacttctccgacatgatgccgcctctggagagccccaccatcgtcgacggcgagggctacgtctcgcaggctagcagctgcgtcgacgtcgatcagcaagccggcatcgtcgactggaacctgctcaccagcttgctgccgccgccggcgcatcagctcttccaccacctgccttccgcttctagctccaagaacagcaacaacatttcttcgtcaggcttcatcgatgaccgagactgatcgatcgatccagatcgattattatcaattgacaattcattcatcatatatatgcatgaattcttacaaatacgcacaattaaacgatcgagtgtactattaattagttgattactccgtctccatgatgtatacattaatttgaccactggccatcatcaggccatctgcatgcttactatctagcttatgtcagtacacggttgttagttcattcttaattaattagctactagtgtcagtgtgtgtatctatcggttgttcgtcttttgacctcattgctgagagaggtttgtaactgatgatgattaagttagctagcatttaattaggtgctatatatacacatatatatgcactatcactatatacatcatatatatgtatacatatatcgttgtctgcttaatgtgtacaccacctctctgcagtatatatagtattgatcaattaatttgt</dnaseqindica> |
| External Link(s) |