Difference between revisions of "Os04g0463400"

From RiceWiki
Jump to: navigation, search
(Function)
(Expression)
Line 6: Line 6:
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
''OsVIT2'' locates in chromosome 4 with four exons and three introns as predicted, and encodes putative protein as the vacuolar iron transporter with 252 amino acids which shares 80.6% amino acid similarity with the VIT in ''Arabidopsis''. There are five conserved transmembrane domains in OsVIT1 by further analyses. This gene expresses in flag leaf blades with a significantly high level<ref name="ref1" />. different from ''OsVIT2'' was quickly induced in rice seedling roots and shoots after the treatment of 4.5 mM FeSO4, ''OsVIT1'' was not highly induced. Fe starvation caused downregulated OsVIT2 expression in roots and shoots, and no OsVIT1 response until 7 days after treatment in roots. These data suggest that OsVIT1 may represent a housekeeping mechanism for Fe accumulation in vacuoles, while OsVIT2 functions more in response to external Fe levels<ref name="ref1" />.
  
 
===Evolution===
 
===Evolution===

Revision as of 10:24, 6 June 2014

Please input one-sentence summary here.

Annotated Information

Function

OsVIT1 and OsVIT2 may function primarily in flag leaves to mediate vacuolar sequestration of Fe and Zn, due to highly expression levels of OsVIT1 and OsVIT2 in flag leaves rather than embryos. And they might also mediate allocation of Fe/Zn between flag leaves and the grains[1]. Knockdown of the vacuolar Fe transporter gene OsVIT1 or OsVIT2 may be useful to further increase the Fe concentration of seeds [2].

Expression

OsVIT2 locates in chromosome 4 with four exons and three introns as predicted, and encodes putative protein as the vacuolar iron transporter with 252 amino acids which shares 80.6% amino acid similarity with the VIT in Arabidopsis. There are five conserved transmembrane domains in OsVIT1 by further analyses. This gene expresses in flag leaf blades with a significantly high level[1]. different from OsVIT2 was quickly induced in rice seedling roots and shoots after the treatment of 4.5 mM FeSO4, OsVIT1 was not highly induced. Fe starvation caused downregulated OsVIT2 expression in roots and shoots, and no OsVIT1 response until 7 days after treatment in roots. These data suggest that OsVIT1 may represent a housekeeping mechanism for Fe accumulation in vacuoles, while OsVIT2 functions more in response to external Fe levels[1].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os04g0463400

Description

Protein of unknown function DUF125, transmembrane family protein

Version

NM_001059545.1 GI:115458819 GeneID:4336075

Length

2850 bp

Definition

Oryza sativa Japonica Group Os04g0463400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:23532796..23535645

Sequence Coding Region

23532960..23533260,23533526..23533640,23533773..23533858,23535286..23535542

Expression

GEO Profiles:Os04g0463400

Genome Context

<gbrowseImage1> name=NC_008397:23532796..23535645 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:23532796..23535645 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggcggcgacggacggcggggggctgccgctgctggcggacaaggcggcgagccacagccaccaccaccacccggagcggcacttcacgtcgggggaggtggtccgcgacgtcatcatgggcgtctccgacggcctcaccgtgcccttcgccctcgccgcggggctctccggcgccagcgcgccatcctcgctcgtgctcaccgccggcctcgccgaggtcgccgccggcgccatctccatgggcctcggagggtatctcgcggccaagagcgaggcagaccattaccagcgggagatgaaaagggagcaggaggagatcatcgccgtcccggacactgaggctgctgagattggcgagatcatgtcgcagtacgggctcgaaccgcatgagtatggccctgtcgtggacgggctccgtaggaatcctcaagcttggctcgacttcatgatgaggtttgagctgggattggagaaaccagaccctaaaagagctatacagagcgctttaacaattgcgctatcttatgtcattggtggactggtccctctccttccctacatgtttatctccacagcacagaacgccatgctcacatctgtcggtgtcacgctggttgcactacttttctttggatacatcaagggtcgctttactggaaaccgtccattcctcagcgctgtccaaactgctattatcggtgcgcttgcttctgctgcggcatatggaatggccaaggccgtgcaaactagatga</cdnaseq>

Protein Sequence

<aaseq>MAAATDGGGLPLLADKAASHSHHHHPERHFTSGEVVRDVIMGVS DGLTVPFALAAGLSGASAPSSLVLTAGLAEVAAGAISMGLGGYLAAKSEADHYQREMK REQEEIIAVPDTEAAEIGEIMSQYGLEPHEYGPVVDGLRRNPQAWLDFMMRFELGLEK PDPKRAIQSALTIALSYVIGGLVPLLPYMFISTAQNAMLTSVGVTLVALLFFGYIKGR FTGNRPFLSAVQTAIIGALASAAAYGMAKAVQTR</aaseq>

Gene Sequence

<dnaseqindica>2386..2686#2006..2120#1788..1873#104..360#aaataaaccacctcttcaaacgtgcgtcgcctgaccgcttccatccatccaccagtctcgcttcttcgtgtctacggtctacctcggcgagtcggcggcggcgatggcggcggcgacggacggcggggggctgccgctgctggcggacaaggcggcgagccacagccaccaccaccacccggagcggcacttcacgtcgggggaggtggtccgcgacgtcatcatgggcgtctccgacggcctcaccgtgcccttcgccctcgccgcggggctctccggcgccagcgcgccatcctcgctcgtgctcaccgccggcctcgccgaggtcgccgccggcgccatctccatgggcctcggagggtaaacattaaacactcatcatctctctgtgtgttccttgtccatgcattgcacccctgaatccctgattaatctagcgaagttagcaatatgtcagtttcgtcgtatagatttgctcttcttttcttttttttttaaagaggggttccgagtttttcattaccaaaacaggaaacccagcggcagggtgcagtagtatgtcagtgaatacaatagaaagctttcggggacccacaggccacagcccataacatgatactagtaatttattaatcacctgaaatcggaatgtactgcagtatgatcatgatgaaacaaaaaattttgatacgccatgcacgcatatatttgctcgtacaattatcgggttccgtcttttgcagagacgcttaacacgtgtctgcgagaataggaaacaattcatacgattggtttgtccaatgatttttacaagatcctatgaaatcataaataatgatttataaaaaaatcctatggaatttctttcaaacaaaaggatctcttaagatgagatgaagattaagtttttcacgcaaaacttttggtattaacatataattgattgagttttaattattacaaacttgaaaaatagattaatatgatattttagagcaagtttcctatagaaagttttcacacgaaacgtacgttaagcaatttgaaaaacgtgccaaaaaattttaatgttcatccaactcttgttggagaaaagaacgagattgtctacggtttttttccctacagcctagaatattttccacgaccttgtagaacaggggagatgtggacaaggcataagcagtacagagtggagactgactggagagatggttgtaaatcgtattaggcgctcgcgcttaaaacatattacttgctgaatataagaagtggagtaatggattaataaaaaaaatggccagcaagcaagttaccgtgctcttggctgttttaatgggagttaggtatgcctgcctgaatatactcacagattcacaggtgtacttgctgaatattgccttgttacctcatgaaaaatcaattaggaaagcccatagtgttcgttgctctgcagattgtgcacggcgtatctgaccttctctgttctttgcctagctcccacccctacagtcccagttgcagattactcctgtcatccaaagcccgaaaaaggagtaattaaagtaaagttagctcgtgatggacacgtgtgtggccctataccacgtgctgttccagcacactttgtgttagtgtcacaacttttaggcctaagaaagtggagaataatactttcccccctttaaactgggaacaagacaagatcacattgttttcaaatcgaaaaaaggcgcgcgcaattgcacaaacgcatgacacttacccgcaattgcaccatgtggtaggtatctcgcggccaagagcgaggcagaccattaccagcgggagatgaaaagggagcaggaggagatcatcgccgtcccggacactggtaagccgataagcagatacaacaagataccatatgctgagacatgtcgctaagattcctcccatctgcgaccagcaggaaagctgcctcactttgtttaaaaaacttttggtttcctggttgatcgatcagaggctgctgagattggcgagatcatgtcgcagtacgggctcgaaccgcatgagtatggccctgtcgtggacgggctccgtaggaatcctcaagcttggctcgacttcatgatgaggtaatatgaccaactgttgctactccctttgtcaatctcttcatcagttatactagaaagcaaatgttgatgtcctgatggtgtctgagatactaatcagaaatgtttcgattatcctgtatgcgtttgccatagctcatataagaagctttcaacaatgaaaaccacacatatattagtaaacagcaagatttcaatcatataaaatataaaaattgatttggaattatcaaaccaacttaactaaccagagcaatgtatgcaggtttgagctgggattggagaaaccagaccctaaaagagctatacagagcgctttaacaattgcgctatcttatgtcattggtggactggtccctctccttccctacatgtttatctccacagcacagaacgccatgctcacatctgtcggtgtcacgctggttgcactacttttctttggatacatcaagggtcgctttactggaaaccgtccattcctcagcgctgtccaaactgctattatcggtgcgcttgcttctgctgcggcatatggaatggccaaggccgtgcaaactagatgatttgaaccctcatgtgttcctgtctgaagtttcagtaggcagaactgaatccaacgaagctgcaatgaatcacaatctcatattaagaatatgtattttacctttcatgtaacaaggaataaattttgggaaacatgaaataaaagcatgctattttaagttct</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0463400, RefSeq:Os04g0463400

  1. 1.0 1.1 1.2 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2