Difference between revisions of "Os10g0497300"

From RiceWiki
Jump to: navigation, search
(Function: RF5 plays a critical role in the assembly of the fertility restoration complex.)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
RF5 plays a critical role in the assembly of the fertility restoration complex. The cloning of fertility restorer genes for CMS from petunia, rapeseed, radish, sorghum, and rice has identified PPR proteins as essential components for fertility restoration. Apart from the PPR13 restorer of fertility in sorghum, which belongs to the E type, all other RF-related proteins belong to the P subclass of PPR proteins. Their structural simplicity suggests the need for additional interaction partners to direct transcript binding and cleavage. PPR4 and PPR2 from maize chloroplasts associate with RNase-sensitive high molecular mass complexes that coprecipitate with ribosomes. In the same vein, Arabidopsis thaliana pTAC2 (for plastid transcriptionally active chromosome 2) was copurified with transcription complexes from chloroplasts. To date, very few direct protein partners of PPR proteins have been identified. The conventional model suggests that RF proteins process CMSassociated transcripts directly, owing to the RNA binding activity of PPR proteins. So far, the fertility restoration complex and its partner proteins have not been identified, and few results have shown direct interactions between the RF and CMS-associated transcripts. A Petunia RF restorer protein, PPR592, associates with a soluble, mitochondrial, RNase-sensitive, high molecular mass protein complex attached to the inner membrane. PPR-B has been demonstrated to associate with the orf138RNAin vivo by immunoprecipitation experiments. It remains unclear whether these interactions between the RNA and RF proteins are direct.In this study, we demonstrated that in mitochondria from the NILF1 hybrid, an RFC with a size of 400 to 500 kD functions in the restoration of fertility. These investigations provided evidence that RF5 is not involved in RNA binding and that RNA processing occurs via a GRP with RNA binding activity that is necessary for the restoration of pollen fertility. We postulate that the critical function of RF5 is to assemble the RFC in mitochondria, wherein Rf5 and GRP coordinate the processing of transcripts involved in fertility restoration in HL-CMS.
  
 
===Expression===
 
===Expression===

Revision as of 16:07, 6 June 2014

Please input one-sentence summary here.

Annotated Information

Function

RF5 plays a critical role in the assembly of the fertility restoration complex. The cloning of fertility restorer genes for CMS from petunia, rapeseed, radish, sorghum, and rice has identified PPR proteins as essential components for fertility restoration. Apart from the PPR13 restorer of fertility in sorghum, which belongs to the E type, all other RF-related proteins belong to the P subclass of PPR proteins. Their structural simplicity suggests the need for additional interaction partners to direct transcript binding and cleavage. PPR4 and PPR2 from maize chloroplasts associate with RNase-sensitive high molecular mass complexes that coprecipitate with ribosomes. In the same vein, Arabidopsis thaliana pTAC2 (for plastid transcriptionally active chromosome 2) was copurified with transcription complexes from chloroplasts. To date, very few direct protein partners of PPR proteins have been identified. The conventional model suggests that RF proteins process CMSassociated transcripts directly, owing to the RNA binding activity of PPR proteins. So far, the fertility restoration complex and its partner proteins have not been identified, and few results have shown direct interactions between the RF and CMS-associated transcripts. A Petunia RF restorer protein, PPR592, associates with a soluble, mitochondrial, RNase-sensitive, high molecular mass protein complex attached to the inner membrane. PPR-B has been demonstrated to associate with the orf138RNAin vivo by immunoprecipitation experiments. It remains unclear whether these interactions between the RNA and RF proteins are direct.In this study, we demonstrated that in mitochondria from the NILF1 hybrid, an RFC with a size of 400 to 500 kD functions in the restoration of fertility. These investigations provided evidence that RF5 is not involved in RNA binding and that RNA processing occurs via a GRP with RNA binding activity that is necessary for the restoration of pollen fertility. We postulate that the critical function of RF5 is to assemble the RFC in mitochondria, wherein Rf5 and GRP coordinate the processing of transcripts involved in fertility restoration in HL-CMS.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os10g0497300

Description

Conserved hypothetical protein

Version

NM_001071493.1 GI:115482729 GeneID:4349007

Length

6882 bp

Definition

Oryza sativa Japonica Group Os10g0497300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:19392891..19399772

Sequence Coding Region

19392997..19395381

Expression

GEO Profiles:Os10g0497300

Genome Context

<gbrowseImage1> name=NC_008403:19392891..19399772 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:19392891..19399772 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgcgccgcgccgcttcccgcgtccgcgccggcgctgttggcgcccttcgctcggagggctcgacccaagggcgagggggccgcacggggggcagtggcgccgaggacgcacgccacgtgttcgacgaattgctccggcgtggcaggggcgcctcgatctacggcttgaactgcgccctcgccgacgtcgcgcgtcacagccccgcggccgccgtgtcccgctacaaccgcatggcccgagccggcgccgacgaggtaactcccaacttgtgcacctacggcattctcatcggttcctgctgctgcgcgggccgcttggacctcggtttcgcggccttgggcaatgtcattaagaagggatttagagtggacgccatcgccttcactcctctgctcaagggcctctgtgctgacaagaggacgagcgacgcaatggacatagtgctccgcagaatgacccagcttggctgcataccaaatgtcttctcctacaatattcttctcaaggggctgtgtgatgagaacagaagccaagaagctctcgagctgctccaaatgatgcctgatgatggaggtgactgcccacctgatgtggtgtcgtataccactgtcatcaatggcttcttcaaggagggggatctggacaaagcttacggtacataccatgaaatgctggaccgggggattttaccaaatgttgttacctacagctctattattgctgcgttatgcaaggctcaagctatggacaaagccatggaggtacttaccagcatggttaagaatggtgtcatgcctaattgcaggacgtataatagtatcgtgcatgggtattgctcttcagggcagccgaaagaggctattggatttctcaaaaagatgcacagtgatggtgtcgaaccagatgttgttacttataactcgctcatggattatctttgcaagaacggaagatgcacggaagctagaaagatgttcgattctatgaccaagaggggcctaaagcctgaaattactacctatggtaccctgcttcaggggtatgctaccaaaggagcccttgttgagatgcatggtctcttggatttgatggtacgaaacggtatccaccctaatcattatgttttcagcattctaatatgtgcatacgctaaacaagggaaagtagatcaggcaatgcttgtgttcagcaaaatgaggcagcaaggattgaatccggatacagtgacctatggaacagttataggcatactttgcaagtcaggcagagtagaagatgctatgcgttattttgagcagatgatcgatgaaagactaagccctggcaacattgtttataactccctaattcatagtctctgtatctttgacaaatgggacaaggctaaagagttaattcttgaaatgttggatcgaggcatctgtctggacactattttctttaattcaataattgacagtcattgcaaagaagggagggttatagaatctgaaaaactctttgacctgatggtacgtattggtgtgaagcccgatatcattacgtacagtactctcatcgatggatattgcttggcaggtaagatggatgaagcaacgaagttacttgccagcatggtctcagttggaatgaaacctgattgtgttacatataatactttgattaatggctactgtaaaattagcaggatggaagatgcgttagttctttttagggagatggagagcagtggtgttagtcctgatattattacgtataatataattctgcaaggtttatttcaaaccagaagaactgctgctgcaaaagaactctatgtcgggattaccgaaagtggaacgcagcttgaacttagcacatacaacataatccttcatgggctttgcaaaaacaatctcactgacgaggcacttcgaatgtttcagaacctatgtttgacggatttacagctggagactaggacttttaacattatgattggtgcattgcttaaagttggcagaaatgatgaagccaaggatttgtttgcagctctctcggctaacggtttagtgccagatgttaggacctacagtttaatggcagaaaatcttatagagcaggggttgctagaagaattggatgatctatttctttcaatggaggagaatggctgtactgccaactcccgcatgctaaattccattgttaggaaactgttacagaggggtgatataaccagggctggcacttacctgttcatgattgatgagaagcacttctccctcgaagcatccactgcttccttgtttttagatcttttgtctgggggaaaatatcaagaatatcataggtttctccctgaaaaatataagtcctttatagaatctttgagctgctga</cdnaseq>

Protein Sequence

<aaseq>MARRAASRVRAGAVGALRSEGSTQGRGGRTGGSGAEDARHVFDE LLRRGRGASIYGLNCALADVARHSPAAAVSRYNRMARAGADEVTPNLCTYGILIGSCC CAGRLDLGFAALGNVIKKGFRVDAIAFTPLLKGLCADKRTSDAMDIVLRRMTQLGCIP NVFSYNILLKGLCDENRSQEALELLQMMPDDGGDCPPDVVSYTTVINGFFKEGDLDKA YGTYHEMLDRGILPNVVTYSSIIAALCKAQAMDKAMEVLTSMVKNGVMPNCRTYNSIV HGYCSSGQPKEAIGFLKKMHSDGVEPDVVTYNSLMDYLCKNGRCTEARKMFDSMTKRG LKPEITTYGTLLQGYATKGALVEMHGLLDLMVRNGIHPNHYVFSILICAYAKQGKVDQ AMLVFSKMRQQGLNPDTVTYGTVIGILCKSGRVEDAMRYFEQMIDERLSPGNIVYNSL IHSLCIFDKWDKAKELILEMLDRGICLDTIFFNSIIDSHCKEGRVIESEKLFDLMVRI GVKPDIITYSTLIDGYCLAGKMDEATKLLASMVSVGMKPDCVTYNTLINGYCKISRME DALVLFREMESSGVSPDIITYNIILQGLFQTRRTAAAKELYVGITESGTQLELSTYNI ILHGLCKNNLTDEALRMFQNLCLTDLQLETRTFNIMIGALLKVGRNDEAKDLFAALSA NGLVPDVRTYSLMAENLIEQGLLEELDDLFLSMEENGCTANSRMLNSIVRKLLQRGDI TRAGTYLFMIDEKHFSLEASTASLFLDLLSGGKYQEYHRFLPEKYKSFIESLSC</aaseq>

Gene Sequence

<dnaseqindica>107..2491#tcccctctatcctccactgctgccgcccacctctccgtatcagctgcgtcgcgttggtttccgccggcgctgctgctgctgcaccagtccgctagggcgggcgggcatggcgcgccgcgccgcttcccgcgtccgcgccggcgctgttggcgcccttcgctcggagggctcgacccaagggcgagggggccgcacggggggcagtggcgccgaggacgcacgccacgtgttcgacgaattgctccggcgtggcaggggcgcctcgatctacggcttgaactgcgccctcgccgacgtcgcgcgtcacagccccgcggccgccgtgtcccgctacaaccgcatggcccgagccggcgccgacgaggtaactcccaacttgtgcacctacggcattctcatcggttcctgctgctgcgcgggccgcttggacctcggtttcgcggccttgggcaatgtcattaagaagggatttagagtggacgccatcgccttcactcctctgctcaagggcctctgtgctgacaagaggacgagcgacgcaatggacatagtgctccgcagaatgacccagcttggctgcataccaaatgtcttctcctacaatattcttctcaaggggctgtgtgatgagaacagaagccaagaagctctcgagctgctccaaatgatgcctgatgatggaggtgactgcccacctgatgtggtgtcgtataccactgtcatcaatggcttcttcaaggagggggatctggacaaagcttacggtacataccatgaaatgctggaccgggggattttaccaaatgttgttacctacagctctattattgctgcgttatgcaaggctcaagctatggacaaagccatggaggtacttaccagcatggttaagaatggtgtcatgcctaattgcaggacgtataatagtatcgtgcatgggtattgctcttcagggcagccgaaagaggctattggatttctcaaaaagatgcacagtgatggtgtcgaaccagatgttgttacttataactcgctcatggattatctttgcaagaacggaagatgcacggaagctagaaagatgttcgattctatgaccaagaggggcctaaagcctgaaattactacctatggtaccctgcttcaggggtatgctaccaaaggagcccttgttgagatgcatggtctcttggatttgatggtacgaaacggtatccaccctaatcattatgttttcagcattctaatatgtgcatacgctaaacaagggaaagtagatcaggcaatgcttgtgttcagcaaaatgaggcagcaaggattgaatccggatacagtgacctatggaacagttataggcatactttgcaagtcaggcagagtagaagatgctatgcgttattttgagcagatgatcgatgaaagactaagccctggcaacattgtttataactccctaattcatagtctctgtatctttgacaaatgggacaaggctaaagagttaattcttgaaatgttggatcgaggcatctgtctggacactattttctttaattcaataattgacagtcattgcaaagaagggagggttatagaatctgaaaaactctttgacctgatggtacgtattggtgtgaagcccgatatcattacgtacagtactctcatcgatggatattgcttggcaggtaagatggatgaagcaacgaagttacttgccagcatggtctcagttggaatgaaacctgattgtgttacatataatactttgattaatggctactgtaaaattagcaggatggaagatgcgttagttctttttagggagatggagagcagtggtgttagtcctgatattattacgtataatataattctgcaaggtttatttcaaaccagaagaactgctgctgcaaaagaactctatgtcgggattaccgaaagtggaacgcagcttgaacttagcacatacaacataatccttcatgggctttgcaaaaacaatctcactgacgaggcacttcgaatgtttcagaacctatgtttgacggatttacagctggagactaggacttttaacattatgattggtgcattgcttaaagttggcagaaatgatgaagccaaggatttgtttgcagctctctcggctaacggtttagtgccagatgttaggacctacagtttaatggcagaaaatcttatagagcaggggttgctagaagaattggatgatctatttctttcaatggaggagaatggctgtactgccaactcccgcatgctaaattccattgttaggaaactgttacagaggggtgatataaccagggctggcacttacctgttcatgattgatgagaagcacttctccctcgaagcatccactgcttccttgtttttagatcttttgtctgggggaaaatatcaagaatatcataggtttctccctgaaaaatataagtcctttatagaatctttgagctgctgaagccttttgcagctttgaaattctgtgttggagttcttttctcctacagttgtattagaggagggatcttctctttatgtgtaaatagcgaggtatgtatgtcacctctccgaattatttttactctggttcctagacggtaaacaagcaattatgttctgcctttgatgccagaaaaaacacaaaagtttgtcgttatctctactaacggatcataaaggaatttgtaactggagtttcaaacttaatttgtctaggcagtagttttggcattagatccaacattgtgtaggattcatttgtgtgtatcaatctatagggtttcattaaatttcgttaatgtgtactgtttaggtgttgaatagtttgacttgttttttaactgaacaaaagatactgaaatcgttccattcaacaaacacatgttccgttaatgaaattattgtacgttaccttttgttttcttactcacaagtgtcctcttttcttatatcctatagattggtacaacaaattattgattcaattttggttttgaacattgatgatcctccctgcactattggtgcagctgctcttctattcattttgtgaagtgatgtgagtacctctcaatcccatccttatgcttctgtgcatgcttcattccaattttttacgcatatcgattgttttcttttatataacagtccataaagataatcacatcatgacaaagttatttatttctacagtatagttatataagtattcaccagttttccatgaatattttggcatgtgattacaaagaagattatttgagaaaatccatgcttttatttcatcattttgtttgaagttgaactttaatttatggtgtaaatttcagttattattgctagcagctcgtactctttaatggtataacttcacttgtgcttattctccaatatctcccttcttgttgttcaggttcaagaaaatcatttgttggattcagaatctggtgtccattttcttcttaaattattaaatcctccagtgaatcttgttgattccaaagcaccatcgataggttccaaacttcttggaatcagtaaagttcaaatgcttaatggatcaaataaggattctgactgcatttcagaggaaatcctttcaaaagttgaagagattctcttaagctgtcaagtgatcaagtcgctcgacaaagatgacaagaaaacaacaaggccagaactgtgtccaaagtggcttgctttgttgacaatggaaaatgcatgcttgtctgctgtttcagtagagggtaagttttaatcaaatttcttggtcatgatttccctttatgaccattatatttatttatatgagccaaataagcagttgtcaacttgtcataagttacatagcacctatttgcaatattcatgggtggtttgcttagcccttttcttcacctgcttttgattgatgacttccatctgtgttgcagaattgaattggagtagtggactgcactagaagcacctatggccattgtcatactaggaaggttttcccttatcaaatatttgattgttacagagacttctgacacagtgtccagagttggaggaaattttaaagagacattaagggagatgggaggtcttgatagtatttttgacgttatggtggattttcattcaacattggaggtgagatctcgctaacatcgcatattttacatttcctttgttcaactctaatggattgtgcaggcttgttccttttcgccattttagctttaatgtgcttgaagccacatgaaagtaatgcttgtccagatacatagccaaaggttgttatattttggggcatggaaaatgcttgaggtagtaactattttcatcaggacatggaaaattggctgcaacacaaattatgttgttttatgttgcaaaaatagttttttaatacttttttattctgcatgtggtgttagtatcttacagttcctctgatgattatatcccccacgataataacacttgaaacgataataacacttgacatatctacaccaagtgaacattattcatttggatgttacttttccagctatacttgctgttcttgcatgtgtaagcaagtttggagtaaattgcgcattaatttaaatgcttggtgttcctatctgtgtactttttattccccaactaataatgcaatcatattacgctgataaactgaataaataaattaacaatatacttctggtggcaaaccttgtgtatcagaatctcataaaggatacatccacttcagctttggaccgaaatgaaggaacatctttgcaaagtgctgctctcctcttgaaatgtttgaaaatattggaaaatgccatatttctaagcgatgataacaaggtaatgctccttatatgttctgtttcagtttagtacccatttccttcttctgtactatcttctctcctgatttgttctgtgcaaaatgtgcaaacagtgcgactttgtatgtctgcttaacaattttcttttcttcctgaaaaagcaatatgaactcttacattcattttgcttcttgcagacccatttgcttaatatgagtagaaaattgaacccgaaacgctccttgctttcttttgttggtgtcattatcaatactattgagttattatcaggtatttttcttaataatacaatgtgttcgctaacacaataaaatgttttaaacatccagtatgttaaagttgcagtctgacgcctattttgttttgctgcagctctttcaatacttcagaattcttctgttgtttccagctctacatatccgaaatcgtctaaagtctctcaacagagttactctggtaataacaaacaccaattttgtttgatcagttgatctcgttggcttttctatgcactgtctcaatatagtttggtcgccattcaagtctcactacagatgttgaacttggcctgacaccaaatatttataaaatgctacctgatatttttaatatttcatgtttcctgacccagattatcttgttggttcctcgtataagtttaattagtgacattcttgaagctttgttatgcagcagatgtcatggggggaacttcatttaatgatggaaagagcaagaactcgaaaaaaaaaaacttttgtcgaaccagacacgtcattgttgcttatcttcaaaatcagaagtttctcatattactatatcttctggtagtgatgctggtctgtcacagaaggcattcaattgttctccatttatatcaagcaatggggcatcaagtggttcattaggcgagaggcacagcaatggtagtggtttgaagttgaatataaaaaaggatcgtggcaatgcaaatccaattagaggctcaactggatggatttcaataagagcgcacagttctgatgggaactccagagaaatggcaaaaagactccgtctatcttaaaatgtaatcaccgacagtggtggtggtgatgacccttttgcatttgaccgccgcgtcggcgtcgccaccacgtaatcgcccacgtcgctgcccccgctgccacgtcgtcgaccgcgcacggtaatcacacgcatctcgaggccgccgctagctgatatcttctcatccggttgatttgtgattttggcgtttttgcagtggtgatggcggggggcgaccgtggccgaggcgtggagtgccatccgcatcagggtgtatcggccgcgctgctccgccctggtccgcaggctttggcggcgagctggcggcggagggagactgtggtgagatcggatttcgccgctggtggtgtcgctaccatgggggattcgccgcaggcgctctcaggtttgcagcctcctccactctcttcccttttttatttttttttctcgcaaaatgtgttgtgatgttcgtctcgctgggcaggcctcatagccattaatgtagtttgctggaacatttacatttggaacgttgttggcaattgcttgacaaaatgtggaattgtggaggggagaaaaatcatttgaacctgcagtgacaaaattgccatctctaattttaaaactgaaggtgtggaaatcaaacataatcattgccagcgcatcattcttgttaaccaccatgatatattgttggttataacagttagctccacaccaaccttgaaggtgtcaatagaatgtttagtataaattgaggagaacaggcagttgttaagactttctaaagaacttgtagcagctaatactagctattgtgcatttgtgtttcatggaatttgagcagcaatggatatttcttactaagatgtatgatgcaaaacaaaaaactatgtctatacagtttacatgtaatgtgcggatgcaaataaaatcatgtacatgg</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0497300, RefSeq:Os10g0497300