Difference between revisions of "Os04g0287400"
(→Function) |
(→Function) |
||
| Line 7: | Line 7: | ||
===Function=== | ===Function=== | ||
| − | |||
| − | |||
Recently, we identified two ABA-inducible and gibberellin (GA)-repressible rice WRKY genes, namely OsWRKY51 and -71.Although OsWRKY51 itself does not bind to the Amy32b promoter in vitro, it interacts with OsWRKY71 and enhances the binding affinity of OsWRKY71 to W boxes in the Amy32b promoter. Titration experiments suggest that the ratio of repressors (such as OsWRKY51 and OsWRKY71) to the activator (e.g. OsGAMYB) seems to determine the expression level of the Amy32b promoter. These data demonstrate the synergistic interaction of ABA-inducible WRKY genes in regulating GAMYB-mediated GA signaling in aleurone cells, thereby establishing a novel mechanism for ABA and GA signaling cross talk.A model is proposed for the role of OsWRKY51 and OsWRKY71 in mediating the cross-talk of GA and ABA signaling. | Recently, we identified two ABA-inducible and gibberellin (GA)-repressible rice WRKY genes, namely OsWRKY51 and -71.Although OsWRKY51 itself does not bind to the Amy32b promoter in vitro, it interacts with OsWRKY71 and enhances the binding affinity of OsWRKY71 to W boxes in the Amy32b promoter. Titration experiments suggest that the ratio of repressors (such as OsWRKY51 and OsWRKY71) to the activator (e.g. OsGAMYB) seems to determine the expression level of the Amy32b promoter. These data demonstrate the synergistic interaction of ABA-inducible WRKY genes in regulating GAMYB-mediated GA signaling in aleurone cells, thereby establishing a novel mechanism for ABA and GA signaling cross talk.A model is proposed for the role of OsWRKY51 and OsWRKY71 in mediating the cross-talk of GA and ABA signaling. | ||
The OsWRKY51/OsWRKY71 repressors form a heterotetramer to bind the W-boxes, thus exerting an antagonistic effect against GA induction of Amy32b. In contrast, GA induces GAMYB, but suppresses OsWRKY51 and OsWRKY71. The ratio of OsWRKY51/OsWRKY71 to GAMYB is low, so that GAMYB competes against the inhibitory effect of OsWRKY51 and OsWRKY71, leading to a high level of α-amylase gene expression. Obviously, this is an over-simplified model because it does not consider other activators, such as OsDOF3, RAMY, and OsMYBS1/OsMYBS2, as well as other repressors, such as KGM (for kinase associated with GAMYB; Woodger et al. 2003) and HRT(for Hordeum repressor of transcription; Raventós et al. 1998).Nevertheless, this model gives us new insights about how multiple transcription factors coordinate to fine tune Amy32b expression triggered by different signals. | The OsWRKY51/OsWRKY71 repressors form a heterotetramer to bind the W-boxes, thus exerting an antagonistic effect against GA induction of Amy32b. In contrast, GA induces GAMYB, but suppresses OsWRKY51 and OsWRKY71. The ratio of OsWRKY51/OsWRKY71 to GAMYB is low, so that GAMYB competes against the inhibitory effect of OsWRKY51 and OsWRKY71, leading to a high level of α-amylase gene expression. Obviously, this is an over-simplified model because it does not consider other activators, such as OsDOF3, RAMY, and OsMYBS1/OsMYBS2, as well as other repressors, such as KGM (for kinase associated with GAMYB; Woodger et al. 2003) and HRT(for Hordeum repressor of transcription; Raventós et al. 1998).Nevertheless, this model gives us new insights about how multiple transcription factors coordinate to fine tune Amy32b expression triggered by different signals. | ||
Revision as of 04:37, 7 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Introduction
The gene symbol is OsWRKY51, and other log number are that NCBI GeneBank:BK005053, RAP-DB:Os04g0287400 and MSU:LOC_Os04g21950. OsWRKY51 belongs to the WRKY family which encodes transcription factors that are involved in the regulation of various biological processes. OsWRKY51 encodes a group II WRKY protein contains one WRKY domain initially defined by a nearly 60 amino acid long motif with a C2H2-type zinc finger motif. The pattern of potential zinc ligands(C-X4-5-C-X22-23-H-X1-H-)is unique among all described zinc-finger-like motifs. Nevertheless, experimental evidence has shown OsWRKY51 can bind sequence specifically to various W box elements (T)(T)TGAC(C/T) containning the invariant TGAC core which is essential for function and WRKY binding.
Function
Recently, we identified two ABA-inducible and gibberellin (GA)-repressible rice WRKY genes, namely OsWRKY51 and -71.Although OsWRKY51 itself does not bind to the Amy32b promoter in vitro, it interacts with OsWRKY71 and enhances the binding affinity of OsWRKY71 to W boxes in the Amy32b promoter. Titration experiments suggest that the ratio of repressors (such as OsWRKY51 and OsWRKY71) to the activator (e.g. OsGAMYB) seems to determine the expression level of the Amy32b promoter. These data demonstrate the synergistic interaction of ABA-inducible WRKY genes in regulating GAMYB-mediated GA signaling in aleurone cells, thereby establishing a novel mechanism for ABA and GA signaling cross talk.A model is proposed for the role of OsWRKY51 and OsWRKY71 in mediating the cross-talk of GA and ABA signaling. The OsWRKY51/OsWRKY71 repressors form a heterotetramer to bind the W-boxes, thus exerting an antagonistic effect against GA induction of Amy32b. In contrast, GA induces GAMYB, but suppresses OsWRKY51 and OsWRKY71. The ratio of OsWRKY51/OsWRKY71 to GAMYB is low, so that GAMYB competes against the inhibitory effect of OsWRKY51 and OsWRKY71, leading to a high level of α-amylase gene expression. Obviously, this is an over-simplified model because it does not consider other activators, such as OsDOF3, RAMY, and OsMYBS1/OsMYBS2, as well as other repressors, such as KGM (for kinase associated with GAMYB; Woodger et al. 2003) and HRT(for Hordeum repressor of transcription; Raventós et al. 1998).Nevertheless, this model gives us new insights about how multiple transcription factors coordinate to fine tune Amy32b expression triggered by different signals.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os04g0287400 |
|---|---|
| Description |
Similar to WRKY transcription factor 51 |
| Version |
NM_001058916.1 GI:115457561 GeneID:4335388 |
| Length |
1399 bp |
| Definition |
Oryza sativa Japonica Group Os04g0287400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 4:12561659..12563057 |
| Sequence Coding Region |
12561842..12562022,12562107..12562232,12562301..12562974 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008397:12561659..12563057 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008397:12561659..12563057 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgattaccatggatctgatgggtgggtacgggcgggtggacgagcaggtggccatccaggaggcggcggcggcggggctaagggggatggagcatcttattctgcagctgtcccagactgggacgagcgagaggtcgccggcgccggcgcaggagcagcagcaacaggtggactgcagggagatcacggacatgacggtgtccaagttcaagaaggtgatctccatgctgaaccgcaccggccacgcgcggttccggcggggcccggtggtggcgcagtcgtcgggcccggcggcgtccgagccggcgccggtgaggtcgtccccgtcggcggtgtcgaggcccatgacgctcgacttcaccaaggcggcgtccgggtacggcaaggacgccgggttcagcgtctccggcatctccgccgcgagctcgtccttcctctcgtcggtcaccggcgacggcagcgtgtccaacgggcgcggcggcgggtcatcctccctgatgcttcccccgccgccggcgaccagctgcggcaagccaccgctgtcctccgccgccgccgccatgtcagccggcgcaggccacaagcgcaagtgccacgaccacgcgcactccgagaacgtcgccggcggcaagtacggatccaccggcggccgctgccactgctccaagcgccggaagcatcgggtgaagaggacgatccgcgtgccggcgataagctcgaaggtggcggacatccccgccgacgacttctcgtggcggaagtacgggcagaagcccatcaagggctcccccttcccacgaggatactacaagtgtagcacgctgcgcggttgcccggcgaggaagcacgtggagcgcgacccgaccgacccgtccatgctcatcgtcacctacgagggcgagcaccgccactccccctccgccgccggccaggaccacccgccggcgccgcctccgccgctggcgctgccgctcgcctga</cdnaseq> |
| Protein Sequence |
<aaseq>MITMDLMGGYGRVDEQVAIQEAAAAGLRGMEHLILQLSQTGTSE RSPAPAQEQQQQVDCREITDMTVSKFKKVISMLNRTGHARFRRGPVVAQSSGPAASEP APVRSSPSAVSRPMTLDFTKAASGYGKDAGFSVSGISAASSSFLSSVTGDGSVSNGRG GGSSSLMLPPPPATSCGKPPLSSAAAAMSAGAGHKRKCHDHAHSENVAGGKYGSTGGR CHCSKRRKHRVKRTIRVPAISSKVADIPADDFSWRKYGQKPIKGSPFPRGYYKCSTLR GCPARKHVERDPTDPSMLIVTYEGEHRHSPSAAGQDHPPAPPPPLALPLA</aaseq> |
| Gene Sequence |
<dnaseqindica>1036..1216#826..951#84..757#acttcttcttcttcttcttccccccatttctcacttactccggcgatcaccgtggttgagcgtcggcggcggaggaggaggcgatgattaccatggatctgatgggtgggtacgggcgggtggacgagcaggtggccatccaggaggcggcggcggcggggctaagggggatggagcatcttattctgcagctgtcccagactgggacgagcgagaggtcgccggcgccggcgcaggagcagcagcaacaggtggactgcagggagatcacggacatgacggtgtccaagttcaagaaggtgatctccatgctgaaccgcaccggccacgcgcggttccggcggggcccggtggtggcgcagtcgtcgggcccggcggcgtccgagccggcgccggtgaggtcgtccccgtcggcggtgtcgaggcccatgacgctcgacttcaccaaggcggcgtccgggtacggcaaggacgccgggttcagcgtctccggcatctccgccgcgagctcgtccttcctctcgtcggtcaccggcgacggcagcgtgtccaacgggcgcggcggcgggtcatcctccctgatgcttcccccgccgccggcgaccagctgcggcaagccaccgctgtcctccgccgccgccgccatgtcagccggcgcaggccacaagcgcaagtgccacgaccacgcgcactccgagaacgtcgccggcggcaagtacggatccaccggcggccgctgccactgctccaagcgccggtaaaaatcttcacgactccctccatttcccccacctcgaattgaactcatcggaattaattttccaggaagcatcgggtgaagaggacgatccgcgtgccggcgataagctcgaaggtggcggacatccccgccgacgacttctcgtggcggaagtacgggcagaagcccatcaagggctcccccttcccacggtgagcaccgcactgccccgccgtctctcctcactccgtcgacattaacactcaaaactaatcgtaatcccctcatttttgcagaggatactacaagtgtagcacgctgcgcggttgcccggcgaggaagcacgtggagcgcgacccgaccgacccgtccatgctcatcgtcacctacgagggcgagcaccgccactccccctccgccgccggccaggaccacccgccggcgccgcctccgccgctggcgctgccgctcgcctgagatacccccggtgaagaagagtgagaattagcttgtcggtcatcataattaccgttagaaattatttttttcgtttttctctctttttttttcttttttttactgcatcattgtagaactagcgtgtaaaacaattttaggagactttgagactgagcttttactgaagaaaaaataaagcag</dnaseqindica> |
| External Link(s) |