Difference between revisions of "Os04g0572400"
(→References) |
|||
| Line 18: | Line 18: | ||
==References== | ==References== | ||
Please input cited references here. | Please input cited references here. | ||
| + | 1. Donghai Mao;Caiyan Chen | ||
| + | Colinearity and Similar Expression Pattern of Rice DREB1s Reveal Their Functional Conservation in the Cold-Responsive Pathway | ||
| + | PLoS ONE, 2012, 7(10): e47275 | ||
| + | 2. Jian-Qiang Chen;Xiu-Ping Meng;Yun Zhang;Mian Xia;Xi-Ping Wang | ||
| + | Over-expression of OsDREB genes lead to enhanced drought tolerance in rice | ||
| + | Biotechnology Letters, 2008, 30(12): 2191-2198 | ||
| + | 3. Xiu-Hong TIAN;Xue-Ping LI;Hua-Lin ZHOU;Jin-Song ZHANG;Zhi-Zhong GONG;Shou-Yi CHEN | ||
| + | OsDREB4 Genes in Rice Encode AP2-Containing Proteins that Bind Specifically to the Dehydration-Responsive Element | ||
| + | Journal of Integrative Plant Biology, 2005, 47(4): 467-476 | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 10:48, 7 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here. 1. Donghai Mao;Caiyan Chen
Colinearity and Similar Expression Pattern of Rice DREB1s Reveal Their Functional Conservation in the Cold-Responsive Pathway PLoS ONE, 2012, 7(10): e47275
2. Jian-Qiang Chen;Xiu-Ping Meng;Yun Zhang;Mian Xia;Xi-Ping Wang
Over-expression of OsDREB genes lead to enhanced drought tolerance in rice Biotechnology Letters, 2008, 30(12): 2191-2198
3. Xiu-Hong TIAN;Xue-Ping LI;Hua-Lin ZHOU;Jin-Song ZHANG;Zhi-Zhong GONG;Shou-Yi CHEN
OsDREB4 Genes in Rice Encode AP2-Containing Proteins that Bind Specifically to the Dehydration-Responsive Element Journal of Integrative Plant Biology, 2005, 47(4): 467-476
Structured Information
| Gene Name |
Os04g0572400 |
|---|---|
| Description |
Similar to CRT/DRE binding factor 1 |
| Version |
NM_001060143.1 GI:115460015 GeneID:4336721 |
| Length |
660 bp |
| Definition |
Oryza sativa Japonica Group Os04g0572400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 4:29219354..29220013 |
| Sequence Coding Region |
29219354..29220013 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008397:29219354..29220013 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008397:29219354..29220013 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggagtgggcgtactacggcagtgggtactcctcgtcggggacgccgtcgccggtgggcggcgacggggacgaggactcgtacatgacggtgtcgtcggcgccgcccaagcggcgggcggggaggaccaagttcaaggagacgaggcacccggtgtacaagggcgtgcgcagcaggaaccccgggaggtgggtctgcgaggtgcgcgagccgcacggcaagcagaggatctggctcggcaccttcgagaccgccgagatggcggcgcgcgcgcacgacgtcgcggcgatggcgctgcgcggccgcgccgcctgcctcaacttcgccgactcgccgcgcaggctccgcgtgccgccgctgggggccgggcacgaggagatacgccgcgccgcggtcgaggccgccgagctgttccgcccggcgcccgggcagcacaatgcggctgccgaggcggcggccgctgtcgctgcgcaggcaaccgcggcgagcgcggagctctttgccgacttcccttgctacccgatggacggactggaattcgaaatgcaggggtacctcgacatggcacagggaatgctcatcgagccgccgccattggcagggcaatcgacgtgggccgaggaggactacgactgcgaggtcaatctatggagctactga</cdnaseq> |
| Protein Sequence |
<aaseq>MEWAYYGSGYSSSGTPSPVGGDGDEDSYMTVSSAPPKRRAGRTK FKETRHPVYKGVRSRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAAMALRGR AACLNFADSPRRLRVPPLGAGHEEIRRAAVEAAELFRPAPGQHNAAAEAAAAVAAQAT AASAELFADFPCYPMDGLEFEMQGYLDMAQGMLIEPPPLAGQSTWAEEDYDCEVNLWS Y</aaseq> |
| Gene Sequence |
<dnaseqindica>1..660#atggagtgggcgtactacggcagtgggtactcctcgtcggggacgccgtcgccggtgggcggcgacggggacgaggactcgtacatgacggtgtcgtcggcgccgcccaagcggcgggcggggaggaccaagttcaaggagacgaggcacccggtgtacaagggcgtgcgcagcaggaaccccgggaggtgggtctgcgaggtgcgcgagccgcacggcaagcagaggatctggctcggcaccttcgagaccgccgagatggcggcgcgcgcgcacgacgtcgcggcgatggcgctgcgcggccgcgccgcctgcctcaacttcgccgactcgccgcgcaggctccgcgtgccgccgctgggggccgggcacgaggagatacgccgcgccgcggtcgaggccgccgagctgttccgcccggcgcccgggcagcacaatgcggctgccgaggcggcggccgctgtcgctgcgcaggcaaccgcggcgagcgcggagctctttgccgacttcccttgctacccgatggacggactggaattcgaaatgcaggggtacctcgacatggcacagggaatgctcatcgagccgccgccattggcagggcaatcgacgtgggccgaggaggactacgactgcgaggtcaatctatggagctactga</dnaseqindica> |
| External Link(s) |