Difference between revisions of "Os11g0446000"

From RiceWiki
Jump to: navigation, search
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
RICE SALT SENSITIVE3 (RSS3), regulates root cell elongation during adaptation to salinity. Loss of function of RSS3 only moderately inhibits cell elongation under normal conditions, but it provokes spontaneous root cell swelling, accompanied by severe root growth inhibition, under saline conditions.
+
RSS3, has a regulatory role in root cell elongation. RSS3 interacts not only with JAZs, but also with non-R/B-like bHLH transcription factors and forms an RSS3-JAZ-bHLH ternary complex in the nucleus. Loss of function of RSS3 activates the expression of a subset of JA-induced genes in the root apex and restricts cell elongation but does not primarily affect cell division activity. Under high-salinity conditions, rss3 mutants exhibit severely inhibited root growth, concomitant with root cell swelling. Loss of function of RSS3 only moderately inhibits cell elongation under normal conditions, but it provokes spontaneous root cell swelling, accompanied by severe root growth inhibition, under saline conditions.
  
 
===Expression===
 
===Expression===

Revision as of 12:28, 7 June 2014

RSS3(rice salt sensitive 3) is a rice nuclear factor,that regulates root cell elongation during adaptation to salinity.

Annotated Information

Function

RSS3, has a regulatory role in root cell elongation. RSS3 interacts not only with JAZs, but also with non-R/B-like bHLH transcription factors and forms an RSS3-JAZ-bHLH ternary complex in the nucleus. Loss of function of RSS3 activates the expression of a subset of JA-induced genes in the root apex and restricts cell elongation but does not primarily affect cell division activity. Under high-salinity conditions, rss3 mutants exhibit severely inhibited root growth, concomitant with root cell swelling. Loss of function of RSS3 only moderately inhibits cell elongation under normal conditions, but it provokes spontaneous root cell swelling, accompanied by severe root growth inhibition, under saline conditions.

Expression

RSS3 is preferentially expressed in the root tip and forms a ternary complex with class-C basic helix-loop-helix (bHLH) transcription factors and JASMONATE ZIM-DOMAIN proteins, the latter of which are the key regulators of jasmonate (JA) signaling. The mutated protein arising from the rss3 allele fails to interact with bHLH factors, and the expression of a significant portion of JA-responsive genes is upregulated in rss3.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

1. Yosuke Toda;Maiko Tanaka;Daisuke Ogawa;Kyo Kurata;Ken-ichi Kurotani;Yoshiki Habu;Tsuyu Ando;Kazuhiko Sugimoto;Nobutaka Mitsuda;Etsuko Katoh;Kiyomi Abe;Akio Miyao;Hirohiko Hirochika;Tsukaho Hattori;Shin Takeda

 RICE SALT SENSITIVE3 Forms a Ternary Complex with JAZ and Class-C bHLH Factors and Regulates Jasmonate-Induced Gene Expression and Root Cell Elongation
 The Plant Cell, 2013, 25(5): 1709-1725

Structured Information

Gene Name

Os11g0446000

Description

Conserved hypothetical protein

Version

NM_001074358.2 GI:297611767 GeneID:4350435

Length

4813 bp

Definition

Oryza sativa Japonica Group Os11g0446000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:16608816..16613628

Sequence Coding Region

16611100..16611258,16612560..16613384

Expression

GEO Profiles:Os11g0446000

Genome Context

<gbrowseImage1> name=NC_008404:16608816..16613628 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:16608816..16613628 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgccgtatgtaccatctcctgcactctcctcctttctctttctgcagagccccctggcccccttgcttttggggggaagagaccttattactgctactactacacacctcattaatcacttgcaaaaacaagctcagcacactgccacagcaacagtgataccggaggacctgcacttcgtgctgcggatgcggcacatgttcgagtcgctcggctaccagtcgggcttcttcctctcccagctcttctcctcctcgcgggggacctcgccgtcgccgtcgtcgttcccgcttaagcagcagcagccgccgccgccgcagctcttcaactggccgggccacgcgccgccgcagctcccgcccggcgcgtcgccgctcttcccgcccgggccggccgcgttccacccgtcgtcccggccaatgccgcccttccccggcggcggcaaggatgagagccacctgttccatctcccgccggcggcggcggccaagcagccgcagcacatggacgagcaccaccaccaccagcagcagccgatggcggcgccgcagcagcacggcggggaggcgcccgagggcgacctgaaatggcccaacgggctgtcgttcttcaccgcgctcaccggccggaccgaggacgcgaagttcctcttcggcggcggcggaggcggcggcgcggacgacgggagcaagacggcggcggcggcgcaggacgcggggcacggcggcgcggagaacgtggaggagtacctgagcctggagagccactccaacaaggcgaggaggatggagagcgcccagagcaccaagttcaagaggagcttcacgttgccggcgaggatgagctcgtccaccacgtcgacgtccccgtcggtgtcggcgtcgacggcgccggcgccgccgcagcagcagcaagggatggagtacaggggcccacacgagggcggcgtctactcggacctaatggagacgttcttggagtag</cdnaseq>

Protein Sequence

<aaseq>MPYVPSPALSSFLFLQSPLAPLLLGGRDLITATTTHLINHLQKQ AQHTATATVIPEDLHFVLRMRHMFESLGYQSGFFLSQLFSSSRGTSPSPSSFPLKQQQ PPPPQLFNWPGHAPPQLPPGASPLFPPGPAAFHPSSRPMPPFPGGGKDESHLFHLPPA AAAKQPQHMDEHHHHQQQPMAAPQQHGGEAPEGDLKWPNGLSFFTALTGRTEDAKFLF GGGGGGGADDGSKTAAAAQDAGHGGAENVEEYLSLESHSNKARRMESAQSTKFKRSFT LPARMSSSTTSTSPSVSASTAPAPPQQQQGMEYRGPHEGGVYSDLMETFLE</aaseq>

Gene Sequence

<dnaseqindica>2285..2443#3745..4569#aagcagcagcagcaggaggtgagagagtgaagagagagacacagccaaagctcagctcagctaagctaagctctactcctactagtagtccctcttcaccctcactctacctcaccctcccccgagaaaaccccaagaaacgatcaaaaagagaccgaccagcaaggccgtagcctcaaagagcagccaaaaccacggagtttttaccatctatcttagctctagcttagctacctagctagcgccggagcagtgaaagagagagtgagagaagaagaagaggaggtggaaagaagtgaaagaaatggtgggctccggggcggcagggggagggggaggtggaggaggaggaggggatcacgcgcgcagcaaagaggccgccgggatgatggctctccacgaggccctccgcaacgtctgcctcaactccgactggacttactccgtcttctggaccatccgtcctcgcccgtatgtgtaccacttaattaattaccacccctcctatgaatttttgcctcaaactctcatctcatctcttctccctatatatatgtcgtcgaaggcggtgccgcggcggcaacgggtgcaaggtcggcgacgacaacggcagcctgtaagtgagcaattgagcatatatacgcacgcacccccaaccaatcgatcgatcgtgtgtgtagttatcaatctggggatatatcatatatgtatgcaggatgctgatgtgggaggacgggttctgccggccgcgggtggcggagtgcctggaggacatcgacggcgaggaccccgtccgcaaggccttcagcaagatgtccatccagctctacaactacggagaagggtgggtgctgggtaggtgatgcagtgcgtaatcgtgtacagtttcgagtgttttttgcccccttggttctcgtggagtcagtcgacgactcgatttggtagtcatgtcagcctctctatcgcatcgcagctgcggatttcttcgctcgaccgtgtcacccgccctgttcttggattaggacccctgcatgcgcgattaatgctaatagtttccccatgattcctgcgtcgtcgtcgtcgccgtcttagagcaagtttaatagtagagttcactactttctattagtcaatattaaagctaacatgtatagtaggttgagtataaggttatctttattttcttcgtcctctctctttctctcactatgaatttaatgcatattttttagagtttgtatacagttagcccttgcatgagaaccaacactccccacttttatttatctctctcttccacataagcatataacttgcttatagactactgttatcctcgctcttagtgtgtgaaagtgcaactctattttggcccaaccagtagtactacactagtacgaccagtcaccagagagaggaggaaaggggaggagatcgatgggatgggcgtgtgcttttttttcatctttttcgctttaaatttgttccaatatttatctaccgttccttgctcgcctgctttgcttttgggtttaaatcagtgtgtgtggtttgaattagttaacctagggtttggttgattttcggatttggtttggttttgacgacgccggggcatcacatcacgcgtggtgcagcgggggtcattatgcgtgggcagaggcgtgggtaaactacaaattaacagccacttaccccctcctaagtcagtggctttaggcgagggctgtcacgtgcgcacgttcgttggggtgcgtgggggcggtgcctcgtatcgcataaacaaatcccggcgcgtcagtggcttaattgcgggctttgtctgcggattaacaacgcccctctgctacgcgcacaacaaaactctacacagcagcaggagcagcagaattgtaaaaaaaatgtttcaagcagatggaaatgatagaatttttttttctgtaccttttcttgtgattctgcgtccatctgtacgtctatgtgagcgtgtcgatgactttagcacagtaatatagtaatatctctgtttggctactgtattggggattaatttgggtaattactactggtaattgcgttaatctggtcgctttcactttgttctactactactaccgagcttttgagcgtgatgttggtaagacgatgattttgatctggaccgctggtgggtgctgctgcaggctgatgggaaaggtggcgtctgataaatgtcacaaatgggtcttcaaggaaccttctgaatgcgagcccaacatcgccaactactggcagagctcttttgatgccgtatgtaccatctcctgcactctcctcctttctctttctgcagagccccctggcccccttgcttttggggggaagagaccttattactgctactactacacacctcattaatcacttgcaaaaacaagctcagcacactgccacagcaacagtggtaggtctcatgtttttactgcgggaatgaggcaaaaaaaagaggaaaaaacaggtaaacagtaaaagagcccgagagagatatatcgacatgtctctggggagttctcaggctttgcatcaaatctgctcgtctgctctgctcccccaaaaagaagagaggaattggatgctctctctcactctctcatcaggatatcaccaagctagtatagaattaacgccgccgatcacagtcacggctaagctttattcctgtgagaacttaaccaaattcccctctcatgcttttgcttttgcagcttcctcccgaatggactgatcagttcgcctctggcatccaggcatgcacttctgttcacctagatcttttacatgctcgtcttagtttgtgattgatatttattagtgatgctaaacttttgcttaatttgcttgtagaccatagcagtgatccaagctggccatggccttcttcagcttggctcttgcaagatcgtgagtacagctatatattgctccctctatttttttaatatataacattgttaattttattctattatatcttttaaacttccatcatcaatagttctctgaatgttcagttaaaaaacgtaaattatactccatccgttctaaaataaactaacatcatactataatgtgatgcatcctattacaacgaatcgaatctgggatgcgttatatcttagtatgaccttggttttttttaagacggatggtgtactacataggtagattttacattataaatggctgtgcaacattacaattttattggatattactccctccgttccataatataatataaggcacaactactttttttagatgttacataatataaggcatgcatacaattaatttctcttctccattaaactattatttttttaaattctccactctcgagatctctaattctattggatgcatgtattatatttattagggtgatctaaactaggagatgataataattgtttcttggtctttggattaagagtggttatacattatattttggaacagagggagtatctttataggggcaattgttatatatatatattttttgatacgaaaataacggttaaagttactccacgcaacagaccgaataaaatgtgtcatatgcatttagtaccgagaggtacagtgagacatggccctttcttgacttgtttttgtcgcgttggtcaaagacgccgacgtggacgtgtttgtggggggcactagctaattgggcaaaacgtacgtacgctaactgtgcagataccggaggacctgcacttcgtgctgcggatgcggcacatgttcgagtcgctcggctaccagtcgggcttcttcctctcccagctcttctcctcctcgcgggggacctcgccgtcgccgtcgtcgttcccgcttaagcagcagcagccgccgccgccgcagctcttcaactggccgggccacgcgccgccgcagctcccgcccggcgcgtcgccgctcttcccgcccgggccggccgcgttccacccgtcgtcccggccaatgccgcccttccccggcggcggcaaggatgagagccacctgttccatctcccgccggcggcggcggccaagcagccgcagcacatggacgagcaccaccaccaccagcagcagccgatggcggcgccgcagcagcacggcggggaggcgcccgagggcgacctgaaatggcccaacgggctgtcgttcttcaccgcgctcaccggccggaccgaggacgcgaagttcctcttcggcggcggcggaggcggcggcgcggacgacgggagcaagacggcggcggcggcgcaggacgcggggcacggcggcgcggagaacgtggaggagtacctgagcctggagagccactccaacaaggcgaggaggatggagagcgcccagagcaccaagttcaagaggagcttcacgttgccggcgaggatgagctcgtccaccacgtcgacgtccccgtcggtgtcggcgtcgacggcgccggcgccgccgcagcagcagcaagggatggagtacaggggcccacacgagggcggcgtctactcggacctaatggagacgttcttggagtagcctaagctagcttagctagcgaccacaccaagctagcaaacatggaagcatgatcatgatcaagtgtttgttcttgtcacctcttagttttttccttcttttctttctcccaaactatgtttaagcttttgagcggtctggtttggagtttgcttctgtttaattaattaattaattagatcatgtagtaatcctttttgttcctccctagttgtactagctctctccaagtgcaaaaacatga</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0446000, RefSeq:Os11g0446000