Difference between revisions of "Os02g0324400"
| Line 8: | Line 8: | ||
Please input evolution information here. | Please input evolution information here. | ||
| − | + | ===Molecular Characterization=== | |
| + | |||
| + | |||
==Labs working on this gene== | ==Labs working on this gene== | ||
Revision as of 13:25, 7 June 2014
The FON2 SPARE1 (FOS1) gene encoding a CLE protein functions along with FON2 in maintenance of in the floral meristem(FM).
Contents
Annotated Information
Function
Our previous study demonstrated that FON2 is a negative regulator of stem cell maintenance in the FM [8]. In this study, introduction of indica FOS1 into fon2-1 by genetic methods using a chromosomal segment substitution line or by Agrobacteriummediated transformation completely suppressed the fon2 mutation. This finding suggests that FOS1 can substitute for the function ofFON2. Thus, FOS1 is likely to play an important role in maintenance of the FM in indica and either one of FOS1 and FON2 appears to be sufficient to restrict stem cell proliferation in the FM.
Expression
FOS1 encodes a secreted protein with a CLE domain, and is expressed in the SAM, IMand FM. Genetic and molecular analyses indicate that FOS1, together with FON2, is likely to be involved in stem cell maintenance in the FM, in rice species in the Oryza genus.
Evolution
Please input evolution information here.
Molecular Characterization
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os02g0324400 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001053232.1 GI:115445834 GeneID:4329179 |
| Length |
1038 bp |
| Definition |
Oryza sativa Japonica Group Os02g0324400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:13043483..13044520 |
| Sequence Coding Region |
13043866..13044261 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:13043483..13044520 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:13043483..13044520 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgagccggcgactcggcgccgcggccgccgtcctcctcctgtggctcgccgtgctcaccttcgccttgcacggctactacggcggccgcctcggctccgcgaggcggcggaatatcctcctccaacacccggcgctagcgctccatctccccaccaggaagatgctcctcgccgtggcgagcttcgacgacgcctcctcgccgtcgtcgttgacgaccaccgatcgtcatcatcaccatcacaggcatcatggccaccaccatcatcgcggccatgatcggtggaacaggaagggtgtcccgccgacggcagctgggccgggcgaggaggtcgacccgcggttcggcgtgcagaagaggctggtcccgacgggccccaaccccctgcaccattga</cdnaseq> |
| Protein Sequence |
<aaseq>MSRRLGAAAAVLLLWLAVLTFALHGYYGGRLGSARRRNILLQHP ALALHLPTRKMLLAVASFDDASSPSSLTTTDRHHHHHRHHGHHHHRGHDRWNRKGVPP TAAGPGEEVDPRFGVQKRLVPTGPNPLHH</aaseq> |
| Gene Sequence |
<dnaseqindica>384..779#ggctcggcgcgcgcgcgcgcgcggcgcgggtggtttacgcaagctgagctgccgccgcgcggcttgctagttagcgtcaaatcgatcggttcgagccctgcaataggagtcccacgcaagcaactccttcctcctcttaaccacgccctctctcaccgtcgtcttcctcaattccctctacccctcaccgcccgcacgcgcgcgctgcctagctaacacaaaccgccattgcttcccctcctcctccttgccgccgtgcttagcttgctgtttgtagcttgttggctagagaggtcgtcgtacgccggtggctggcgatcgccggccggccggtggtccatgactaacggtgccgcgagctgccagcctgcagcgcggtggacatgagccggcgactcggcgccgcggccgccgtcctcctcctgtggctcgccgtgctcaccttcgccttgcacggctactacggcggccgcctcggctccgcgaggcggcggaatatcctcctccaacacccggcgctagcgctccatctccccaccaggaagatgctcctcgccgtggcgagcttcgacgacgcctcctcgccgtcgtcgttgacgaccaccgatcgtcatcatcaccatcacaggcatcatggccaccaccatcatcgcggccatgatcggtggaacaggaagggtgtcccgccgacggcagctgggccgggcgaggaggtcgacccgcggttcggcgtgcagaagaggctggtcccgacgggccccaaccccctgcaccattgatgccggcggctcgccattgatgggtgctcgagtttttctgcggtgagtcacgcgcacatatacactactacaccgttcttgttgtgttcatcgatcgaccaaaggctagctagctagctagcacagtaatattgattccaattccaacctgtggatgaattcaagaaagcattgccgatgtgtgtgtgctcttgcatgtatgtaccacgatcatatcagaaagcttcaaaacaagaggagaaaaagaaatgttactagc</dnaseqindica> |
| External Link(s) |