Difference between revisions of "Os02g0324400"
| Line 4: | Line 4: | ||
===Function=== | ===Function=== | ||
Our previous study demonstrated that FON2 is a negative regulator of stem cell maintenance in the FM [8]. In this study, introduction of indica FOS1 into fon2-1 by genetic methods using a chromosomal segment substitution line or by Agrobacteriummediated transformation completely suppressed the fon2 mutation. This finding suggests that FOS1 can substitute for the function ofFON2. Thus, FOS1 is likely to play an important role in maintenance of the FM in indica and either one of FOS1 and FON2 appears to be sufficient to restrict stem cell proliferation in the FM. | Our previous study demonstrated that FON2 is a negative regulator of stem cell maintenance in the FM [8]. In this study, introduction of indica FOS1 into fon2-1 by genetic methods using a chromosomal segment substitution line or by Agrobacteriummediated transformation completely suppressed the fon2 mutation. This finding suggests that FOS1 can substitute for the function ofFON2. Thus, FOS1 is likely to play an important role in maintenance of the FM in indica and either one of FOS1 and FON2 appears to be sufficient to restrict stem cell proliferation in the FM. | ||
| + | [[File:Figure1. Indica FOS1 suppresses the floral phenotypes caused by the fon2 or fon1 mutation.jpg|right|104px|"Indica FOS1 suppresses the floral phenotypes caused by the fon2 or fon1 mutation(from reference<ref name="ref3"/)." ]] | ||
===Expression=== | ===Expression=== | ||
Revision as of 14:26, 7 June 2014
The FON2 SPARE1 (FOS1) gene encoding a CLE protein functions along with FON2 in maintenance of in the floral meristem(FM).
Annotated Information
Function
Our previous study demonstrated that FON2 is a negative regulator of stem cell maintenance in the FM [8]. In this study, introduction of indica FOS1 into fon2-1 by genetic methods using a chromosomal segment substitution line or by Agrobacteriummediated transformation completely suppressed the fon2 mutation. This finding suggests that FOS1 can substitute for the function ofFON2. Thus, FOS1 is likely to play an important role in maintenance of the FM in indica and either one of FOS1 and FON2 appears to be sufficient to restrict stem cell proliferation in the FM. [[File:Figure1. Indica FOS1 suppresses the floral phenotypes caused by the fon2 or fon1 mutation.jpg|right|104px|"Indica FOS1 suppresses the floral phenotypes caused by the fon2 or fon1 mutation(from reference[1]
Structured Information
| Gene Name |
Os02g0324400 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001053232.1 GI:115445834 GeneID:4329179 |
| Length |
1038 bp |
| Definition |
Oryza sativa Japonica Group Os02g0324400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:13043483..13044520 |
| Sequence Coding Region |
13043866..13044261 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:13043483..13044520 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:13043483..13044520 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgagccggcgactcggcgccgcggccgccgtcctcctcctgtggctcgccgtgctcaccttcgccttgcacggctactacggcggccgcctcggctccgcgaggcggcggaatatcctcctccaacacccggcgctagcgctccatctccccaccaggaagatgctcctcgccgtggcgagcttcgacgacgcctcctcgccgtcgtcgttgacgaccaccgatcgtcatcatcaccatcacaggcatcatggccaccaccatcatcgcggccatgatcggtggaacaggaagggtgtcccgccgacggcagctgggccgggcgaggaggtcgacccgcggttcggcgtgcagaagaggctggtcccgacgggccccaaccccctgcaccattga</cdnaseq> |
| Protein Sequence |
<aaseq>MSRRLGAAAAVLLLWLAVLTFALHGYYGGRLGSARRRNILLQHP ALALHLPTRKMLLAVASFDDASSPSSLTTTDRHHHHHRHHGHHHHRGHDRWNRKGVPP TAAGPGEEVDPRFGVQKRLVPTGPNPLHH</aaseq> |
| Gene Sequence |
<dnaseqindica>384..779#ggctcggcgcgcgcgcgcgcgcggcgcgggtggtttacgcaagctgagctgccgccgcgcggcttgctagttagcgtcaaatcgatcggttcgagccctgcaataggagtcccacgcaagcaactccttcctcctcttaaccacgccctctctcaccgtcgtcttcctcaattccctctacccctcaccgcccgcacgcgcgcgctgcctagctaacacaaaccgccattgcttcccctcctcctccttgccgccgtgcttagcttgctgtttgtagcttgttggctagagaggtcgtcgtacgccggtggctggcgatcgccggccggccggtggtccatgactaacggtgccgcgagctgccagcctgcagcgcggtggacatgagccggcgactcggcgccgcggccgccgtcctcctcctgtggctcgccgtgctcaccttcgccttgcacggctactacggcggccgcctcggctccgcgaggcggcggaatatcctcctccaacacccggcgctagcgctccatctccccaccaggaagatgctcctcgccgtggcgagcttcgacgacgcctcctcgccgtcgtcgttgacgaccaccgatcgtcatcatcaccatcacaggcatcatggccaccaccatcatcgcggccatgatcggtggaacaggaagggtgtcccgccgacggcagctgggccgggcgaggaggtcgacccgcggttcggcgtgcagaagaggctggtcccgacgggccccaaccccctgcaccattgatgccggcggctcgccattgatgggtgctcgagtttttctgcggtgagtcacgcgcacatatacactactacaccgttcttgttgtgttcatcgatcgaccaaaggctagctagctagctagcacagtaatattgattccaattccaacctgtggatgaattcaagaaagcattgccgatgtgtgtgtgctcttgcatgtatgtaccacgatcatatcagaaagcttcaaaacaagaggagaaaaagaaatgttactagc</dnaseqindica> |
| External Link(s) |
- ↑ Takuya Suzaki;Masako Ohneda;Taiyo Toriba;Akiko Yoshida;Hiro-Yuki Hirano FON2 SPARE1 Redundantly Regulates Floral Meristem Maintenance with FLORAL ORGAN NUMBER2 in Rice PLoS Genetics, 2009, 5(10): 1-9
