Difference between revisions of "Os05g0543000"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
Pectins are fundamental polysaccharides in the plant primary cell wall. Pectins are synthesized and secreted to cell walls as highly methyl-esterified polymers and then demethyl-esterified by pectin methylesterases (PMEs), which are spatially regulated by pectin methylesterase inhibitors (PMEIs). [1] OSIPP3 is an anther-specific gene of rice encoding pectin methylesterase inhibitor family protein.
 
Pectins are fundamental polysaccharides in the plant primary cell wall. Pectins are synthesized and secreted to cell walls as highly methyl-esterified polymers and then demethyl-esterified by pectin methylesterases (PMEs), which are spatially regulated by pectin methylesterase inhibitors (PMEIs). [1] OSIPP3 is an anther-specific gene of rice encoding pectin methylesterase inhibitor family protein.
 +
Germination of pollen and pollen tube elongation are significant processes in plant sexual reproduction. The apical cell wall of the pollen tube is exclusively made up of pectin. Pectins are synthesized and methylesterified in the Golgi and are later released in the apoplastic space. Further these methylesterified pectin polymers are demethylesterified by a class of enzymes named as pectin methyl esterases (PMEs). PMEs are ubiquitous enzymes and play an important role in pollen tube growth. In plants, the activity of PME is regulated either by differential expression or by PME inhibitor proteins (PMEI) (Micheli 2001). PMEI inhibit the activity of PME of plant origin and have a role in regulating cell wall stability at the tip of pollen tube (Di Matteo et al. 2005).
  
 
===Expression===
 
===Expression===

Revision as of 14:45, 7 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Pectins are fundamental polysaccharides in the plant primary cell wall. Pectins are synthesized and secreted to cell walls as highly methyl-esterified polymers and then demethyl-esterified by pectin methylesterases (PMEs), which are spatially regulated by pectin methylesterase inhibitors (PMEIs). [1] OSIPP3 is an anther-specific gene of rice encoding pectin methylesterase inhibitor family protein. Germination of pollen and pollen tube elongation are significant processes in plant sexual reproduction. The apical cell wall of the pollen tube is exclusively made up of pectin. Pectins are synthesized and methylesterified in the Golgi and are later released in the apoplastic space. Further these methylesterified pectin polymers are demethylesterified by a class of enzymes named as pectin methyl esterases (PMEs). PMEs are ubiquitous enzymes and play an important role in pollen tube growth. In plants, the activity of PME is regulated either by differential expression or by PME inhibitor proteins (PMEI) (Micheli 2001). PMEI inhibit the activity of PME of plant origin and have a role in regulating cell wall stability at the tip of pollen tube (Di Matteo et al. 2005).

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os05g0543000

Description

Plant invertase/pectin methylesterase inhibitor domain containing protein

Version

NM_001062735.1 GI:115465200 GeneID:4339485

Length

1347 bp

Definition

Oryza sativa Japonica Group Os05g0543000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:27009633..27010979

Sequence Coding Region

27009778..27009975,27010401..27010823

Expression

GEO Profiles:Os05g0543000

Genome Context

<gbrowseImage1> name=NC_008398:27009633..27010979 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:27009633..27010979 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgcgattcgtcatcatctccgtcgtcgtcgtcgccgccttcgccgctgccgctgtcgttgaggcccgggttggacctatcgacgtcgctccgaccaacctgatcaccaacccactcggtgccatcatcgacaatggccgcaagatcaccggcgccgtcgtcgacgagtgcgcctggacctgcgatcatgtcgcggcgggtaacaagaagatgtgcaacacgctgaggaagctgccgggggtgagctcgccgaaggagctcctgacggcggcggtgaagctgtcgatgaggaaggcgaaggcggcgagggcgaggttcgaggcggcggcgagggcggcggagaaggggacgccgatggagtccatcctggacacctgcaaggaagggtacgacagcacggtgtcggcgctgcaggaggtgcagcgctgcatcgacgccaacgacagcaaggcgagcctcatcaccaagatgtcggcggcgaccaccttcaccggcgactgcggcaacgcctacgaggagcgggagctggagcccagcctcgcgctcaaggccaccaagaacaacgtcaaccgcgtcgtcaccggcgccctcgccatcgccgccaagctcaagctataa</cdnaseq>

Protein Sequence

<aaseq>MARFVIISVVVVAAFAAAAVVEARVGPIDVAPTNLITNPLGAII DNGRKITGAVVDECAWTCDHVAAGNKKMCNTLRKLPGVSSPKELLTAAVKLSMRKAKA ARARFEAAARAAEKGTPMESILDTCKEGYDSTVSALQEVQRCIDANDSKASLITKMSA ATTFTGDCGNAYEERELEPSLALKATKNNVNRVVTGALAIAAKLKL</aaseq>

Gene Sequence

<dnaseqindica>146..343#769..1191#agccatcaccaaaccttttagcttctcagccttttgcctctctttctactctctttcttggccgtctctcttatatccctcaatttaaccatcgagggcggccaaaaaaaagagagaaaggaagagcaaaataacacattacaccatggcgcgattcgtcatcatctccgtcgtcgtcgtcgccgccttcgccgctgccgctgtcgttgaggcccgggttggacctatcgacgtcgctccgaccaacctgatcaccaacccactcggtgccatcatcgacaatggccgcaagatcaccggcgccgtcgtcgacgagtgcgcctggacctgcgatcatgtcgcggtgagtgacgacactattgtccatggaagcttattttgatcgctcgagagggtccctcgtatttatatgtcacttaaataattataaaaaaattaaaaaaattaagaagacgtgttaacctgtgatatatcaccccacaaacatacacgttcaaattcaacttctgtatctcgcaacgaaaaaaataaattaaaccaaatatagatgtttaatttgaacttggatatttgtgaagtgatatataacatgttaatacatcttctcgaattttttttaatttttttataactatttgagtgacatgtaaacaatgagggaatgatgttcctcgagggattaaaatccactcccgctccagaaatggtcagaaaattacttactgctcatgtcatggatgaacagtctgtctattgatgttgatgcaggcgggtaacaagaagatgtgcaacacgctgaggaagctgccgggggtgagctcgccgaaggagctcctgacggcggcggtgaagctgtcgatgaggaaggcgaaggcggcgagggcgaggttcgaggcggcggcgagggcggcggagaaggggacgccgatggagtccatcctggacacctgcaaggaagggtacgacagcacggtgtcggcgctgcaggaggtgcagcgctgcatcgacgccaacgacagcaaggcgagcctcatcaccaagatgtcggcggcgaccaccttcaccggcgactgcggcaacgcctacgaggagcgggagctggagcccagcctcgcgctcaaggccaccaagaacaacgtcaaccgcgtcgtcaccggcgccctcgccatcgccgccaagctcaagctataattagccaactgatcatcaatcgatatgaatgattgatcaactataaaattacacctagctcatgcatgcgtccgcgcgttatgtgtgtacgcacgcatgcatatgtgtaagatcgatcaacagatcacagaagtggtggcgtatctcgcacttgtg</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0543000, RefSeq:Os05g0543000