Difference between revisions of "Os05g0588500"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
−
MtN3 and saliva related transmembrane protein family protein gene.
+
*Os05g0588500, also named '''OsSWEET5''', is a member of SWEETs, a MtN3 and saliva related transmembrane protein family<ref name="ref1" /><ref name="ref2" />.
−
 
 
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
−
Please input function information here.
+
*OsSWEET5 encodes a sugar transporter protein involved in galactose transport<ref name="ref3" />.  
−
 
+
*Overexpression of OsSWEET5 causes growth retardation, precocious senescence, galactose accumulation and disordered sugar distribution, results in the inhibition of auxin signaling and translocation<ref name="ref4" /><ref name="ref5" /><ref name="ref6" />.
−
===Expression===
+
*Knockout of OsSWEET5 causes no obvious phenotypes.
−
Please input expression information here.
 
  
−
===Evolution===
+
===Expression Pattern===
−
Please input evolution information here.
+
*OsSWEET5 was mainly expressed in the floral organs at the heading stage, and was also detectable in stem, root and senescing leaves.
  
−
You can also add sub-section(s) at will.
+
===Subcellular Localization===
 +
*OsSWEET5 encoded a plasma membrane protein.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
−
Please input related labs here.
+
*National Key Laboratory of Crop Genetic Improvement and National Centre of Plant Gene Research, Huazhong Agricultural University, Wuhan, China.
 +
*Plant Reproductive Biology, University of California Davis, Davis, California, United States of America.
  
 
==References==
 
==References==
−
Please input cited references here.
+
* <ref name="ref1">
 +
Chen LQ, Hou BH, Lalonde S, Takanaga H, Hartung ML, et al. (2010) Sugar transporters for intercellular exchange and nutrition of pathogens. Nature 468: 527–532.
 +
* <ref name="ref2">
 +
Yuan M, Wang S (2013) Rice MtN3/Saliva/SWEET family genes and their homologs in cellular organisms. Mol Plant 6: 665–674.
 +
* <ref name="ref3">
 +
Zhou Y, Liu L, Huang W, Yuan M, Zhou F, et al. (2014) Overexpression of OsSWEET5 in Rice Causes Growth Retardation and Precocious Senescence. PLoS ONE 9(4): e94210. doi:10.1371/journal.pone.0094210
 +
* <ref name="ref4">
 +
Anker L (1974) Auxin-synthesis inhibition by sugars, notably by galactose. Acta Bot Neerl 23: 705–714.
 +
* <ref name="ref5">
 +
Cheung SP, Cleland RE (1991) Galactose inhibits auxin-induced growth of Avena coleoptiles by two mechanisms. Plant Cell Physiol 32: 1015–1019.
 +
* <ref name="ref6">
 +
Krul WR, Colclasure GC (1977) Effect of galactose and other monosaccharides on IAA movement in bean hypocotyl segments. Physiol Plant 41: 249–253.
  
 
==Structured Information==
 
==Structured Information==

Revision as of 15:00, 7 June 2014

  • Os05g0588500, also named OsSWEET5, is a member of SWEETs, a MtN3 and saliva related transmembrane protein family[1][2].

Annotated Information

Function

  • OsSWEET5 encodes a sugar transporter protein involved in galactose transport[3].
  • Overexpression of OsSWEET5 causes growth retardation, precocious senescence, galactose accumulation and disordered sugar distribution, results in the inhibition of auxin signaling and translocation[4][5][6].
  • Knockout of OsSWEET5 causes no obvious phenotypes.

Expression Pattern

  • OsSWEET5 was mainly expressed in the floral organs at the heading stage, and was also detectable in stem, root and senescing leaves.

Subcellular Localization

  • OsSWEET5 encoded a plasma membrane protein.

Labs working on this gene

  • National Key Laboratory of Crop Genetic Improvement and National Centre of Plant Gene Research, Huazhong Agricultural University, Wuhan, China.
  • Plant Reproductive Biology, University of California Davis, Davis, California, United States of America.

References

  • <ref name="ref1">

Chen LQ, Hou BH, Lalonde S, Takanaga H, Hartung ML, et al. (2010) Sugar transporters for intercellular exchange and nutrition of pathogens. Nature 468: 527–532.

  • <ref name="ref2">

Yuan M, Wang S (2013) Rice MtN3/Saliva/SWEET family genes and their homologs in cellular organisms. Mol Plant 6: 665–674.

  • <ref name="ref3">

Zhou Y, Liu L, Huang W, Yuan M, Zhou F, et al. (2014) Overexpression of OsSWEET5 in Rice Causes Growth Retardation and Precocious Senescence. PLoS ONE 9(4): e94210. doi:10.1371/journal.pone.0094210

  • <ref name="ref4">

Anker L (1974) Auxin-synthesis inhibition by sugars, notably by galactose. Acta Bot Neerl 23: 705–714.

  • <ref name="ref5">

Cheung SP, Cleland RE (1991) Galactose inhibits auxin-induced growth of Avena coleoptiles by two mechanisms. Plant Cell Physiol 32: 1015–1019.

  • <ref name="ref6">

Krul WR, Colclasure GC (1977) Effect of galactose and other monosaccharides on IAA movement in bean hypocotyl segments. Physiol Plant 41: 249–253.

Structured Information

Gene Name

Os05g0588500

Description

MtN3 and saliva related transmembrane protein family protein

Version

NM_001063010.1 GI:115465750 GeneID:4339772

Length

1812 bp

Definition

Oryza sativa Japonica Group Os05g0588500, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:29394637..29396448

Sequence Coding Region

29394950..29395081,29395237..29395356,29395475..29395890,29396068..29396113

Expression

GEO Profiles:Os05g0588500

Genome Context

<gbrowseImage1> name=NC_008398:29394637..29396448 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:29394637..29396448 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtgatgaaccctgacgccgtccgcaatgtcgttggaatcatcggtaacttgatatcgttcgggttgttcttgtcgccattgccgacgttcgtgacgatcgtgaagaagaaggacgtggaggagttcgtgccggatccgtacctggcgacgttcctcaactgcgcgctgtgggtgttctacggcctacccttcatccaccccaacagcatcctcgtcgtcaccatcaacggcaccggactcctcatcgagatcgcctacctcgccatctacttcgcctacgcccccaagcccaagcggtgcaggatgctcggcgtcctcaccgtggagctcgtcttcctcgccgccgtcgccgccggcgtgctcctcggcgcccacacctacgacaagcgctcgctcatcgttggcaccctctgcgtcttcttcggcaccctcatgtacgccgcgccgctcaccatcatgaaacaagtgatcgcgacaaagagcgtggagtacatgcccttcacgttgtcgctggtgagcttcatcaacggcatatgctggacaatatacgcgttcatccgctttgacatcctcatcacgataccgaacggcatggggacgctgctgggcgcggcgcagttgatcctctacttctgctactacgacgggtcgacggccaagaacaagggcgccctcgagctgcccaaggacggcgactcctccgctgtgtag</cdnaseq>

Protein Sequence

<aaseq>MVMNPDAVRNVVGIIGNLISFGLFLSPLPTFVTIVKKKDVEEFV PDPYLATFLNCALWVFYGLPFIHPNSILVVTINGTGLLIEIAYLAIYFAYAPKPKRCR MLGVLTVELVFLAAVAAGVLLGAHTYDKRSLIVGTLCVFFGTLMYAAPLTIMKQVIAT KSVEYMPFTLSLVSFINGICWTIYAFIRFDILITIPNGMGTLLGAAQLILYFCYYDGS TAKNKGALELPKDGDSSAV</aaseq>

Gene Sequence

<dnaseqindica>1368..1499#1093..1212#559..974#336..381#gtgctctgcctctccattattccgactctcgtaagattaaggggggaggaattggagggcagaggccgccattttaatcagtggaaataaaatccacgcattttatatatttaatttaacccccaattttaacttagcagcacactagctagctagctgctaagttaactatttgatcaggttacagttgctggcctgacagttaattaatctcttgctggttgattagttgctatcagctacacgctctcgctagctgccactgtactaatacatactcccatctattcgcctgagaaaatatcgaaaagtagcagcaaagaggagcaggcaagatggtgatgaaccctgacgccgtccgcaatgtcgttggaatcatcggtacgtcgtctcgaattgaacctgcttgtagatgcttcatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatattgatcgaacattagtaattgactaataattgattaattgtactaggtaacttgatatcgttcgggttgttcttgtcgccattgccgacgttcgtgacgatcgtgaagaagaaggacgtggaggagttcgtgccggatccgtacctggcgacgttcctcaactgcgcgctgtgggtgttctacggcctacccttcatccaccccaacagcatcctcgtcgtcaccatcaacggcaccggactcctcatcgagatcgcctacctcgccatctacttcgcctacgcccccaagcccaagcggtgcaggatgctcggcgtcctcaccgtggagctcgtcttcctcgccgccgtcgccgccggcgtgctcctcggcgcccacacctacgacaagcgctcgctcatcgttggcaccctctgcgtcttcttcggcaccctcatgtacgccgcgccgctcaccatcatggtatgtgtatatatatctgtcgattattaattttttgcatgaatctgatctgatgattaattatttgatttatatgtgtgtggcaaaatgatgtaattactacatggaatgaatgtagaaacaagtgatcgcgacaaagagcgtggagtacatgcccttcacgttgtcgctggtgagcttcatcaacggcatatgctggacaatatacgcgttcatccgctttgacatcctcatcacggtatacatattatgcatgcatatatatatatatgctttcaattatctcataaataattactaggatcagtaagtagtatagttgttattataatcatagagtaattctagctaatagtactatatattaatgtatcataattaataaataaatagataccgaacggcatggggacgctgctgggcgcggcgcagttgatcctctacttctgctactacgacgggtcgacggccaagaacaagggcgccctcgagctgcccaaggacggcgactcctccgctgtgtagctacatatgctatatatcttgccatgcaaagaaccacaagatcgaagctaacacaaaccatgcagcatatatgcacatcacacatgcagtatcacaacgtacgcatgcttggatctgcacgcaccacgcgcgcgtgcatgtaactgtgacgggttataatcgatctgttggatggatatggatcatggatgcaggcaatgcagctgctcttctgtttggacccactgaattcgcccgtgcatgcaggcagcttctttgtgtgtgtacatatccaactatgcaagaggcaggtatatgtgagcaaaaggccccc</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0588500, RefSeq:Os05g0588500

  1. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  5. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref5
  6. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref6
Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0588500&oldid=180342"