Difference between revisions of "Os05g0588500"

From RiceWiki
Jump to: navigation, search
Line 18: Line 18:
 
==References==
 
==References==
 
<references>
 
<references>
* <ref name="ref1">
+
<ref name="ref1">
Chen LQ, Hou BH, Lalonde S, Takanaga H, Hartung ML, et al. (2010) Sugar transporters for intercellular exchange and nutrition of pathogens. Nature 468: 527–532.  
+
Chen LQ, Hou BH, Lalonde S, Takanaga H, Hartung ML, et al. (2010) Sugar transporters for intercellular exchange and nutrition of pathogens. Nature 468: 527–532.</ref>
* <ref name="ref2">
+
<ref name="ref2">
Yuan M, Wang S (2013) Rice MtN3/Saliva/SWEET family genes and their homologs in cellular organisms. Mol Plant 6: 665–674.
+
Yuan M, Wang S (2013) Rice MtN3/Saliva/SWEET family genes and their homologs in cellular organisms. Mol Plant 6: 665–674.</ref>
* <ref name="ref3">
+
<ref name="ref3">
Zhou Y, Liu L, Huang W, Yuan M, Zhou F, et al. (2014) Overexpression of OsSWEET5 in Rice Causes Growth Retardation and Precocious Senescence. PLoS ONE 9(4): e94210. doi:10.1371/journal.pone.0094210
+
Zhou Y, Liu L, Huang W, Yuan M, Zhou F, et al. (2014) Overexpression of OsSWEET5 in Rice Causes Growth Retardation and Precocious Senescence. PLoS ONE 9(4): e94210. doi:10.1371/journal.pone.0094210</ref>
* <ref name="ref4">
+
<ref name="ref4">
Anker L (1974) Auxin-synthesis inhibition by sugars, notably by galactose. Acta Bot Neerl 23: 705–714.
+
Anker L (1974) Auxin-synthesis inhibition by sugars, notably by galactose. Acta Bot Neerl 23: 705–714.</ref>
* <ref name="ref5">
+
<ref name="ref5">
Cheung SP, Cleland RE (1991) Galactose inhibits auxin-induced growth of Avena coleoptiles by two mechanisms. Plant Cell Physiol 32: 1015–1019.
+
Cheung SP, Cleland RE (1991) Galactose inhibits auxin-induced growth of Avena coleoptiles by two mechanisms. Plant Cell Physiol 32: 1015–1019.</ref>
* <ref name="ref6">
+
<ref name="ref6">
Krul WR, Colclasure GC (1977) Effect of galactose and other monosaccharides on IAA movement in bean hypocotyl segments. Physiol Plant 41: 249–253.
+
Krul WR, Colclasure GC (1977) Effect of galactose and other monosaccharides on IAA movement in bean hypocotyl segments. Physiol Plant 41: 249–253.</ref>
 
</references>
 
</references>
 
==Structured Information==
 
==Structured Information==

Revision as of 15:03, 7 June 2014

  • Os05g0588500, also named OsSWEET5, is a member of SWEETs, a MtN3 and saliva related transmembrane protein family[1][2].

Annotated Information

Function

  • OsSWEET5 encodes a sugar transporter protein involved in galactose transport[3].
  • Overexpression of OsSWEET5 causes growth retardation, precocious senescence, galactose accumulation and disordered sugar distribution, results in the inhibition of auxin signaling and translocation[4][5][6].
  • Knockout of OsSWEET5 causes no obvious phenotypes.

Expression Pattern

  • OsSWEET5 was mainly expressed in the floral organs at the heading stage, and was also detectable in stem, root and senescing leaves.

Subcellular Localization

  • OsSWEET5 encoded a plasma membrane protein.

Labs working on this gene

  • National Key Laboratory of Crop Genetic Improvement and National Centre of Plant Gene Research, Huazhong Agricultural University, Wuhan, China.
  • Plant Reproductive Biology, University of California Davis, Davis, California, United States of America.

References

  1. Chen LQ, Hou BH, Lalonde S, Takanaga H, Hartung ML, et al. (2010) Sugar transporters for intercellular exchange and nutrition of pathogens. Nature 468: 527–532.
  2. Yuan M, Wang S (2013) Rice MtN3/Saliva/SWEET family genes and their homologs in cellular organisms. Mol Plant 6: 665–674.
  3. Zhou Y, Liu L, Huang W, Yuan M, Zhou F, et al. (2014) Overexpression of OsSWEET5 in Rice Causes Growth Retardation and Precocious Senescence. PLoS ONE 9(4): e94210. doi:10.1371/journal.pone.0094210
  4. Anker L (1974) Auxin-synthesis inhibition by sugars, notably by galactose. Acta Bot Neerl 23: 705–714.
  5. Cheung SP, Cleland RE (1991) Galactose inhibits auxin-induced growth of Avena coleoptiles by two mechanisms. Plant Cell Physiol 32: 1015–1019.
  6. Krul WR, Colclasure GC (1977) Effect of galactose and other monosaccharides on IAA movement in bean hypocotyl segments. Physiol Plant 41: 249–253.

Structured Information

Gene Name

Os05g0588500

Description

MtN3 and saliva related transmembrane protein family protein

Version

NM_001063010.1 GI:115465750 GeneID:4339772

Length

1812 bp

Definition

Oryza sativa Japonica Group Os05g0588500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:29394637..29396448

Sequence Coding Region

29394950..29395081,29395237..29395356,29395475..29395890,29396068..29396113

Expression

GEO Profiles:Os05g0588500

Genome Context

<gbrowseImage1> name=NC_008398:29394637..29396448 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:29394637..29396448 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtgatgaaccctgacgccgtccgcaatgtcgttggaatcatcggtaacttgatatcgttcgggttgttcttgtcgccattgccgacgttcgtgacgatcgtgaagaagaaggacgtggaggagttcgtgccggatccgtacctggcgacgttcctcaactgcgcgctgtgggtgttctacggcctacccttcatccaccccaacagcatcctcgtcgtcaccatcaacggcaccggactcctcatcgagatcgcctacctcgccatctacttcgcctacgcccccaagcccaagcggtgcaggatgctcggcgtcctcaccgtggagctcgtcttcctcgccgccgtcgccgccggcgtgctcctcggcgcccacacctacgacaagcgctcgctcatcgttggcaccctctgcgtcttcttcggcaccctcatgtacgccgcgccgctcaccatcatgaaacaagtgatcgcgacaaagagcgtggagtacatgcccttcacgttgtcgctggtgagcttcatcaacggcatatgctggacaatatacgcgttcatccgctttgacatcctcatcacgataccgaacggcatggggacgctgctgggcgcggcgcagttgatcctctacttctgctactacgacgggtcgacggccaagaacaagggcgccctcgagctgcccaaggacggcgactcctccgctgtgtag</cdnaseq>

Protein Sequence

<aaseq>MVMNPDAVRNVVGIIGNLISFGLFLSPLPTFVTIVKKKDVEEFV PDPYLATFLNCALWVFYGLPFIHPNSILVVTINGTGLLIEIAYLAIYFAYAPKPKRCR MLGVLTVELVFLAAVAAGVLLGAHTYDKRSLIVGTLCVFFGTLMYAAPLTIMKQVIAT KSVEYMPFTLSLVSFINGICWTIYAFIRFDILITIPNGMGTLLGAAQLILYFCYYDGS TAKNKGALELPKDGDSSAV</aaseq>

Gene Sequence

<dnaseqindica>1368..1499#1093..1212#559..974#336..381#gtgctctgcctctccattattccgactctcgtaagattaaggggggaggaattggagggcagaggccgccattttaatcagtggaaataaaatccacgcattttatatatttaatttaacccccaattttaacttagcagcacactagctagctagctgctaagttaactatttgatcaggttacagttgctggcctgacagttaattaatctcttgctggttgattagttgctatcagctacacgctctcgctagctgccactgtactaatacatactcccatctattcgcctgagaaaatatcgaaaagtagcagcaaagaggagcaggcaagatggtgatgaaccctgacgccgtccgcaatgtcgttggaatcatcggtacgtcgtctcgaattgaacctgcttgtagatgcttcatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatattgatcgaacattagtaattgactaataattgattaattgtactaggtaacttgatatcgttcgggttgttcttgtcgccattgccgacgttcgtgacgatcgtgaagaagaaggacgtggaggagttcgtgccggatccgtacctggcgacgttcctcaactgcgcgctgtgggtgttctacggcctacccttcatccaccccaacagcatcctcgtcgtcaccatcaacggcaccggactcctcatcgagatcgcctacctcgccatctacttcgcctacgcccccaagcccaagcggtgcaggatgctcggcgtcctcaccgtggagctcgtcttcctcgccgccgtcgccgccggcgtgctcctcggcgcccacacctacgacaagcgctcgctcatcgttggcaccctctgcgtcttcttcggcaccctcatgtacgccgcgccgctcaccatcatggtatgtgtatatatatctgtcgattattaattttttgcatgaatctgatctgatgattaattatttgatttatatgtgtgtggcaaaatgatgtaattactacatggaatgaatgtagaaacaagtgatcgcgacaaagagcgtggagtacatgcccttcacgttgtcgctggtgagcttcatcaacggcatatgctggacaatatacgcgttcatccgctttgacatcctcatcacggtatacatattatgcatgcatatatatatatatgctttcaattatctcataaataattactaggatcagtaagtagtatagttgttattataatcatagagtaattctagctaatagtactatatattaatgtatcataattaataaataaatagataccgaacggcatggggacgctgctgggcgcggcgcagttgatcctctacttctgctactacgacgggtcgacggccaagaacaagggcgccctcgagctgcccaaggacggcgactcctccgctgtgtagctacatatgctatatatcttgccatgcaaagaaccacaagatcgaagctaacacaaaccatgcagcatatatgcacatcacacatgcagtatcacaacgtacgcatgcttggatctgcacgcaccacgcgcgcgtgcatgtaactgtgacgggttataatcgatctgttggatggatatggatcatggatgcaggcaatgcagctgctcttctgtttggacccactgaattcgcccgtgcatgcaggcagcttctttgtgtgtgtacatatccaactatgcaagaggcaggtatatgtgagcaaaaggccccc</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0588500, RefSeq:Os05g0588500