Difference between revisions of "Os05g0588500"
| Line 18: | Line 18: | ||
==References== | ==References== | ||
<references> | <references> | ||
| − | + | <ref name="ref1"> | |
| − | Chen LQ, Hou BH, Lalonde S, Takanaga H, Hartung ML, et al. (2010) Sugar transporters for intercellular exchange and nutrition of pathogens. Nature 468: 527–532. | + | Chen LQ, Hou BH, Lalonde S, Takanaga H, Hartung ML, et al. (2010) Sugar transporters for intercellular exchange and nutrition of pathogens. Nature 468: 527–532.</ref> |
| − | + | <ref name="ref2"> | |
| − | Yuan M, Wang S (2013) Rice MtN3/Saliva/SWEET family genes and their homologs in cellular organisms. Mol Plant 6: 665–674. | + | Yuan M, Wang S (2013) Rice MtN3/Saliva/SWEET family genes and their homologs in cellular organisms. Mol Plant 6: 665–674.</ref> |
| − | + | <ref name="ref3"> | |
| − | Zhou Y, Liu L, Huang W, Yuan M, Zhou F, et al. (2014) Overexpression of OsSWEET5 in Rice Causes Growth Retardation and Precocious Senescence. PLoS ONE 9(4): e94210. doi:10.1371/journal.pone.0094210 | + | Zhou Y, Liu L, Huang W, Yuan M, Zhou F, et al. (2014) Overexpression of OsSWEET5 in Rice Causes Growth Retardation and Precocious Senescence. PLoS ONE 9(4): e94210. doi:10.1371/journal.pone.0094210</ref> |
| − | + | <ref name="ref4"> | |
| − | Anker L (1974) Auxin-synthesis inhibition by sugars, notably by galactose. Acta Bot Neerl 23: 705–714. | + | Anker L (1974) Auxin-synthesis inhibition by sugars, notably by galactose. Acta Bot Neerl 23: 705–714.</ref> |
| − | + | <ref name="ref5"> | |
| − | Cheung SP, Cleland RE (1991) Galactose inhibits auxin-induced growth of Avena coleoptiles by two mechanisms. Plant Cell Physiol 32: 1015–1019. | + | Cheung SP, Cleland RE (1991) Galactose inhibits auxin-induced growth of Avena coleoptiles by two mechanisms. Plant Cell Physiol 32: 1015–1019.</ref> |
| − | + | <ref name="ref6"> | |
| − | Krul WR, Colclasure GC (1977) Effect of galactose and other monosaccharides on IAA movement in bean hypocotyl segments. Physiol Plant 41: 249–253. | + | Krul WR, Colclasure GC (1977) Effect of galactose and other monosaccharides on IAA movement in bean hypocotyl segments. Physiol Plant 41: 249–253.</ref> |
</references> | </references> | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 15:03, 7 June 2014
- Os05g0588500, also named OsSWEET5, is a member of SWEETs, a MtN3 and saliva related transmembrane protein family[1][2].
Contents
Annotated Information
Function
- OsSWEET5 encodes a sugar transporter protein involved in galactose transport[3].
- Overexpression of OsSWEET5 causes growth retardation, precocious senescence, galactose accumulation and disordered sugar distribution, results in the inhibition of auxin signaling and translocation[4][5][6].
- Knockout of OsSWEET5 causes no obvious phenotypes.
Expression Pattern
- OsSWEET5 was mainly expressed in the floral organs at the heading stage, and was also detectable in stem, root and senescing leaves.
Subcellular Localization
- OsSWEET5 encoded a plasma membrane protein.
Labs working on this gene
- National Key Laboratory of Crop Genetic Improvement and National Centre of Plant Gene Research, Huazhong Agricultural University, Wuhan, China.
- Plant Reproductive Biology, University of California Davis, Davis, California, United States of America.
References
- ↑ Chen LQ, Hou BH, Lalonde S, Takanaga H, Hartung ML, et al. (2010) Sugar transporters for intercellular exchange and nutrition of pathogens. Nature 468: 527–532.
- ↑ Yuan M, Wang S (2013) Rice MtN3/Saliva/SWEET family genes and their homologs in cellular organisms. Mol Plant 6: 665–674.
- ↑ Zhou Y, Liu L, Huang W, Yuan M, Zhou F, et al. (2014) Overexpression of OsSWEET5 in Rice Causes Growth Retardation and Precocious Senescence. PLoS ONE 9(4): e94210. doi:10.1371/journal.pone.0094210
- ↑ Anker L (1974) Auxin-synthesis inhibition by sugars, notably by galactose. Acta Bot Neerl 23: 705–714.
- ↑ Cheung SP, Cleland RE (1991) Galactose inhibits auxin-induced growth of Avena coleoptiles by two mechanisms. Plant Cell Physiol 32: 1015–1019.
- ↑ Krul WR, Colclasure GC (1977) Effect of galactose and other monosaccharides on IAA movement in bean hypocotyl segments. Physiol Plant 41: 249–253.
Structured Information
| Gene Name |
Os05g0588500 |
|---|---|
| Description |
MtN3 and saliva related transmembrane protein family protein |
| Version |
NM_001063010.1 GI:115465750 GeneID:4339772 |
| Length |
1812 bp |
| Definition |
Oryza sativa Japonica Group Os05g0588500, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 5:29394637..29396448 |
| Sequence Coding Region |
29394950..29395081,29395237..29395356,29395475..29395890,29396068..29396113 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008398:29394637..29396448 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008398:29394637..29396448 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggtgatgaaccctgacgccgtccgcaatgtcgttggaatcatcggtaacttgatatcgttcgggttgttcttgtcgccattgccgacgttcgtgacgatcgtgaagaagaaggacgtggaggagttcgtgccggatccgtacctggcgacgttcctcaactgcgcgctgtgggtgttctacggcctacccttcatccaccccaacagcatcctcgtcgtcaccatcaacggcaccggactcctcatcgagatcgcctacctcgccatctacttcgcctacgcccccaagcccaagcggtgcaggatgctcggcgtcctcaccgtggagctcgtcttcctcgccgccgtcgccgccggcgtgctcctcggcgcccacacctacgacaagcgctcgctcatcgttggcaccctctgcgtcttcttcggcaccctcatgtacgccgcgccgctcaccatcatgaaacaagtgatcgcgacaaagagcgtggagtacatgcccttcacgttgtcgctggtgagcttcatcaacggcatatgctggacaatatacgcgttcatccgctttgacatcctcatcacgataccgaacggcatggggacgctgctgggcgcggcgcagttgatcctctacttctgctactacgacgggtcgacggccaagaacaagggcgccctcgagctgcccaaggacggcgactcctccgctgtgtag</cdnaseq> |
| Protein Sequence |
<aaseq>MVMNPDAVRNVVGIIGNLISFGLFLSPLPTFVTIVKKKDVEEFV PDPYLATFLNCALWVFYGLPFIHPNSILVVTINGTGLLIEIAYLAIYFAYAPKPKRCR MLGVLTVELVFLAAVAAGVLLGAHTYDKRSLIVGTLCVFFGTLMYAAPLTIMKQVIAT KSVEYMPFTLSLVSFINGICWTIYAFIRFDILITIPNGMGTLLGAAQLILYFCYYDGS TAKNKGALELPKDGDSSAV</aaseq> |
| Gene Sequence |
<dnaseqindica>1368..1499#1093..1212#559..974#336..381#gtgctctgcctctccattattccgactctcgtaagattaaggggggaggaattggagggcagaggccgccattttaatcagtggaaataaaatccacgcattttatatatttaatttaacccccaattttaacttagcagcacactagctagctagctgctaagttaactatttgatcaggttacagttgctggcctgacagttaattaatctcttgctggttgattagttgctatcagctacacgctctcgctagctgccactgtactaatacatactcccatctattcgcctgagaaaatatcgaaaagtagcagcaaagaggagcaggcaagatggtgatgaaccctgacgccgtccgcaatgtcgttggaatcatcggtacgtcgtctcgaattgaacctgcttgtagatgcttcatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatattgatcgaacattagtaattgactaataattgattaattgtactaggtaacttgatatcgttcgggttgttcttgtcgccattgccgacgttcgtgacgatcgtgaagaagaaggacgtggaggagttcgtgccggatccgtacctggcgacgttcctcaactgcgcgctgtgggtgttctacggcctacccttcatccaccccaacagcatcctcgtcgtcaccatcaacggcaccggactcctcatcgagatcgcctacctcgccatctacttcgcctacgcccccaagcccaagcggtgcaggatgctcggcgtcctcaccgtggagctcgtcttcctcgccgccgtcgccgccggcgtgctcctcggcgcccacacctacgacaagcgctcgctcatcgttggcaccctctgcgtcttcttcggcaccctcatgtacgccgcgccgctcaccatcatggtatgtgtatatatatctgtcgattattaattttttgcatgaatctgatctgatgattaattatttgatttatatgtgtgtggcaaaatgatgtaattactacatggaatgaatgtagaaacaagtgatcgcgacaaagagcgtggagtacatgcccttcacgttgtcgctggtgagcttcatcaacggcatatgctggacaatatacgcgttcatccgctttgacatcctcatcacggtatacatattatgcatgcatatatatatatatgctttcaattatctcataaataattactaggatcagtaagtagtatagttgttattataatcatagagtaattctagctaatagtactatatattaatgtatcataattaataaataaatagataccgaacggcatggggacgctgctgggcgcggcgcagttgatcctctacttctgctactacgacgggtcgacggccaagaacaagggcgccctcgagctgcccaaggacggcgactcctccgctgtgtagctacatatgctatatatcttgccatgcaaagaaccacaagatcgaagctaacacaaaccatgcagcatatatgcacatcacacatgcagtatcacaacgtacgcatgcttggatctgcacgcaccacgcgcgcgtgcatgtaactgtgacgggttataatcgatctgttggatggatatggatcatggatgcaggcaatgcagctgctcttctgtttggacccactgaattcgcccgtgcatgcaggcagcttctttgtgtgtgtacatatccaactatgcaagaggcaggtatatgtgagcaaaaggccccc</dnaseqindica> |
| External Link(s) |
