Difference between revisions of "Os05g0543000"
(→Function) |
(→References) |
||
| Line 18: | Line 18: | ||
==References== | ==References== | ||
| − | + | [1]Maojun Wang, Daojun Yuan mail, Wenhui Gao, Yang Li, Jiafu Tan, Xianlong Zhang et al. A Comparative Genome Analysis of PME and PMEI Families Reveals the Evolution of Pectin Metabolism in Plant Cell Walls. PLOS ONE. AUG 12 2013. | |
| + | [2]Reema Khurana, Hitesh Kathuria, Arnab Mukhopadhyay, Sanjay Kapoor, Akhilesh K. Tyagi et al. A 286 bp upstream regulatory region of a rice anther-Specific gene, OSIPP3, confers pollen-specific expression in Arabidopsis. Biotechnol Lett (2013) 35:455–462 | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 15:10, 7 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
“Pectins are fundamental polysaccharides in the plant primary cell wall. Pectins are synthesized and secreted to cell walls as highly methyl-esterified polymers and then demethyl-esterified by pectin methylesterases (PMEs), which are spatially regulated by pectin methylesterase inhibitors (PMEIs). ”[1] “OSIPP3 is an anther-specific gene of rice encoding pectin methylesterase inhibitor family protein. Germination of pollen and pollen tube elongation are significant processes in plant sexual reproduction. The apical cell wall of the pollen tube is exclusively made up of pectin. Pectins are synthesized and methylesterified in the Golgi and are later released in the apoplastic space. Further these methylesterified pectin polymers are demethylesterified by a class of enzymes named as pectin methyl esterases (PMEs). PMEs are ubiquitous enzymes and play an important role in pollen tube growth. In plants, the activity of PME is regulated either by differential expression or by PME inhibitor proteins (PMEI) (Micheli 2001). PMEI inhibit the activity of PME of plant origin and have a role in regulating cell wall stability at the tip of pollen tube (Di Matteo et al. 2005).”[2]
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
[1]Maojun Wang, Daojun Yuan mail, Wenhui Gao, Yang Li, Jiafu Tan, Xianlong Zhang et al. A Comparative Genome Analysis of PME and PMEI Families Reveals the Evolution of Pectin Metabolism in Plant Cell Walls. PLOS ONE. AUG 12 2013. [2]Reema Khurana, Hitesh Kathuria, Arnab Mukhopadhyay, Sanjay Kapoor, Akhilesh K. Tyagi et al. A 286 bp upstream regulatory region of a rice anther-Specific gene, OSIPP3, confers pollen-specific expression in Arabidopsis. Biotechnol Lett (2013) 35:455–462
Structured Information
| Gene Name |
Os05g0543000 |
|---|---|
| Description |
Plant invertase/pectin methylesterase inhibitor domain containing protein |
| Version |
NM_001062735.1 GI:115465200 GeneID:4339485 |
| Length |
1347 bp |
| Definition |
Oryza sativa Japonica Group Os05g0543000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 5:27009633..27010979 |
| Sequence Coding Region |
27009778..27009975,27010401..27010823 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008398:27009633..27010979 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008398:27009633..27010979 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgcgattcgtcatcatctccgtcgtcgtcgtcgccgccttcgccgctgccgctgtcgttgaggcccgggttggacctatcgacgtcgctccgaccaacctgatcaccaacccactcggtgccatcatcgacaatggccgcaagatcaccggcgccgtcgtcgacgagtgcgcctggacctgcgatcatgtcgcggcgggtaacaagaagatgtgcaacacgctgaggaagctgccgggggtgagctcgccgaaggagctcctgacggcggcggtgaagctgtcgatgaggaaggcgaaggcggcgagggcgaggttcgaggcggcggcgagggcggcggagaaggggacgccgatggagtccatcctggacacctgcaaggaagggtacgacagcacggtgtcggcgctgcaggaggtgcagcgctgcatcgacgccaacgacagcaaggcgagcctcatcaccaagatgtcggcggcgaccaccttcaccggcgactgcggcaacgcctacgaggagcgggagctggagcccagcctcgcgctcaaggccaccaagaacaacgtcaaccgcgtcgtcaccggcgccctcgccatcgccgccaagctcaagctataa</cdnaseq> |
| Protein Sequence |
<aaseq>MARFVIISVVVVAAFAAAAVVEARVGPIDVAPTNLITNPLGAII DNGRKITGAVVDECAWTCDHVAAGNKKMCNTLRKLPGVSSPKELLTAAVKLSMRKAKA ARARFEAAARAAEKGTPMESILDTCKEGYDSTVSALQEVQRCIDANDSKASLITKMSA ATTFTGDCGNAYEERELEPSLALKATKNNVNRVVTGALAIAAKLKL</aaseq> |
| Gene Sequence |
<dnaseqindica>146..343#769..1191#agccatcaccaaaccttttagcttctcagccttttgcctctctttctactctctttcttggccgtctctcttatatccctcaatttaaccatcgagggcggccaaaaaaaagagagaaaggaagagcaaaataacacattacaccatggcgcgattcgtcatcatctccgtcgtcgtcgtcgccgccttcgccgctgccgctgtcgttgaggcccgggttggacctatcgacgtcgctccgaccaacctgatcaccaacccactcggtgccatcatcgacaatggccgcaagatcaccggcgccgtcgtcgacgagtgcgcctggacctgcgatcatgtcgcggtgagtgacgacactattgtccatggaagcttattttgatcgctcgagagggtccctcgtatttatatgtcacttaaataattataaaaaaattaaaaaaattaagaagacgtgttaacctgtgatatatcaccccacaaacatacacgttcaaattcaacttctgtatctcgcaacgaaaaaaataaattaaaccaaatatagatgtttaatttgaacttggatatttgtgaagtgatatataacatgttaatacatcttctcgaattttttttaatttttttataactatttgagtgacatgtaaacaatgagggaatgatgttcctcgagggattaaaatccactcccgctccagaaatggtcagaaaattacttactgctcatgtcatggatgaacagtctgtctattgatgttgatgcaggcgggtaacaagaagatgtgcaacacgctgaggaagctgccgggggtgagctcgccgaaggagctcctgacggcggcggtgaagctgtcgatgaggaaggcgaaggcggcgagggcgaggttcgaggcggcggcgagggcggcggagaaggggacgccgatggagtccatcctggacacctgcaaggaagggtacgacagcacggtgtcggcgctgcaggaggtgcagcgctgcatcgacgccaacgacagcaaggcgagcctcatcaccaagatgtcggcggcgaccaccttcaccggcgactgcggcaacgcctacgaggagcgggagctggagcccagcctcgcgctcaaggccaccaagaacaacgtcaaccgcgtcgtcaccggcgccctcgccatcgccgccaagctcaagctataattagccaactgatcatcaatcgatatgaatgattgatcaactataaaattacacctagctcatgcatgcgtccgcgcgttatgtgtgtacgcacgcatgcatatgtgtaagatcgatcaacagatcacagaagtggtggcgtatctcgcacttgtg</dnaseqindica> |
| External Link(s) |