Difference between revisions of "Os01g0776600"

From RiceWiki
Jump to: navigation, search
Line 25: Line 25:
 
Please input cited references here.
 
Please input cited references here.
 
<references />
 
<references />
<ref name="ref1">Tian J, Wang C, Zhang Q, He X, Whelan J, Shou H(2012) Overexpression ofOsPAP10a, a root-associated acid phosphatase, increased extracellular organic phosphorus utilization in rice.J. Integr. Plant Biol.54(9), 631–639.</ref>
+
<ref >Tian J, Wang C, Zhang Q, He X, Whelan J, Shou H(2012) Overexpression ofOsPAP10a, a root-associated acid phosphatase, increased extracellular organic phosphorus utilization in rice.J. Integr. Plant Biol.54(9), 631–639.</ref>
 
<ref name="ref2">Zhang Q, Wang C, Tian J, Li K, Shou H(2011) Identification of rice purple acid phosphatases related to phosphate starvation signalling. Plant Biol.13,7–15.</ref>
 
<ref name="ref2">Zhang Q, Wang C, Tian J, Li K, Shou H(2011) Identification of rice purple acid phosphatases related to phosphate starvation signalling. Plant Biol.13,7–15.</ref>
</references>
+
 
 
==Structured Information==
 
==Structured Information==
 
{{JaponicaGene|
 
{{JaponicaGene|

Revision as of 02:18, 8 June 2014

Please input one-sentence summary here. Although PAP protein sequences display high levels of similarity, their functions and modes of regulation vary considerably. Using in-gel activity assays, we were able to show that the induction of APase activity by Pi deficiency is predominantly attributed to the increased expression of OsPAP10a, which is under the control of OsPHR2, the central transcription factor controlling Pi homeostasis in rice. Overexpression of OsPAP10ain rice increased shoot and root-associated APase activities in both Pi-replete and Pi-deficient conditions. As a consequence, the transgenic plants were able to hydrolyze extracellular organic P sources, such as ATP, into an inorganic form more efficiently than WT plants. However, substrate specificity still needs to be investigated.

Annotated Information

Function

Please input function information here. OsPAP10a is a major APase isoform in both shoot and root protein extracts, and is specifically induced by Pi-deficient conditions. OsPAP10acan be secreted and that overexpression of OsPAP10ais associated with improved hydrolysis capacity of external organic P and thus better phosphate use efficiency.

Expression

Please input expression information here. The expression of OsPAP10a is induced by Pi deprivation, other nutrient stresses had no or little influence on the expression of OsPAP10a. Pi starvation highly induced the level of expression of OsPAP10a in wild type (WT) plants. In OsPAP10a-overexpressing plants, OsPAP10atranscript abundance was higher in both Pi-sufficient and deficient conditions than it was in WT plants (Figure 3A). Interestingly, the transcript level of OsPAP10ain OsPAP10aoverexpressing plants grown under Pi-replete conditions was even higher than that in WT plants grown under Pi-deficient conditions.

Evolution

Please input evolution information here. In plants, the PAP family has been previously classified into seven groups and OsPAP10abelongs to group Ia. In rice, group Ia contains 5 members, namely OsPAP10a to OsPAP10d, and OsPAP26. You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here Phylogenetic and expression analysis Protein extraction and APase activity assay Reverse transcript PCR (RT-PCR) In-Gel APase activity staining Root-associated acid phosphatase activity assay

References

Please input cited references here.

[1] [2]

Structured Information

Gene Name

Os01g0776600

Description

Similar to Purple acid phosphatase (EC 3.1.3.2)

Version

NM_001050951.1 GI:115440272 GeneID:4327894

Length

4254 bp

Definition

Oryza sativa Japonica Group Os01g0776600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:34604132..34608385

Sequence Coding Region

34604468..34604666,34604767..34604888,34605209..34605429,34605674..34605812,34605938..34606164
,34606265..34606376,34606451..34606651,34607937..34608113

Expression

GEO Profiles:Os01g0776600

Genome Context

<gbrowseImage1> name=NC_008394:34604132..34608385 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:34604132..34608385 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtggaccggatcggcgccgcgtggtggtgcgcgtgcgccgtggggatgctggtggtgggggcgtgcctcgccggggagaccagcgagtaccggcgccagctcggctccgccgtcgacatgccgctcgacgccgacgtcttccgcgccccgcccggccgcaatgcgccccagcaggttcatatcacacaaggaaatcatgatggcactgccatgataatctcatgggtgacaacaattgagccaggctcaagcactgtgctctatgggacttcggaggataatcttaatttctctgcagatggaaaacacactcagtatacgttctacaactacacctcaggatacattcatcactgtacaataaaaaagttggagtttgacacaaaatactactatgctgttgggattggacaaaccgtgaggaagttttggttcagaacccctccaaaaagtggcccagatgttccatatacatttggtctcataggtgatcttggtcagagctacgactcgaatattacgctggcccattatgagtccaattcaaaggcgcaagcagtacttttcgttggggatctgtgttatgcagataactacccataccatgacaatgtgaggtgggatacatgggcaagatttgtagagaggaatgttgcctaccagccttggatctggacagctggaaatcatgagatagattttgccccagaacttggtgaaacgaagccattcaagccatacagctataggtaccccacaccttataaggcttccggtagcacggcacctttctggtattctgtcaaaagagcatctgcttatattattgtcttggcatcatattcatcatatggaaagtatactcctcagtacaagtggcttgaagctgagtttcccaaggttaacaggagtgaaacgccatggttgatagtgctattgcatgctccgtggtacaacagctataactatcactacatggaaggtgaaagcatgagagttatgtatgagccgtggttcgtcaagtacaaagttgacctcgtgtttgcaggacatgttcatgcctatgaacggacacacaggatatcaaatgtcgcgtacaacattgtgaatggccagtgcactccagtccatgatcagtctgctccagtctacataaccatcggagatggaggaaaccaggaaggactggccaccaacatgacggcgccgcagcctggctactcggccttcagggagtcgagcttcgggcacgccatcctggacatcaagaacaggacgcacgcgtactacacgtggcaccgcaaccaggacggcaacgctgtggcggctgactccatgtggttcaccaacagatactggcagccgacggatgaatctttggacgactcccagtga</cdnaseq>

Protein Sequence

<aaseq>MVDRIGAAWWCACAVGMLVVGACLAGETSEYRRQLGSAVDMPLD ADVFRAPPGRNAPQQVHITQGNHDGTAMIISWVTTIEPGSSTVLYGTSEDNLNFSADG KHTQYTFYNYTSGYIHHCTIKKLEFDTKYYYAVGIGQTVRKFWFRTPPKSGPDVPYTF GLIGDLGQSYDSNITLAHYESNSKAQAVLFVGDLCYADNYPYHDNVRWDTWARFVERN VAYQPWIWTAGNHEIDFAPELGETKPFKPYSYRYPTPYKASGSTAPFWYSVKRASAYI IVLASYSSYGKYTPQYKWLEAEFPKVNRSETPWLIVLLHAPWYNSYNYHYMEGESMRV MYEPWFVKYKVDLVFAGHVHAYERTHRISNVAYNIVNGQCTPVHDQSAPVYITIGDGG NQEGLATNMTAPQPGYSAFRESSFGHAILDIKNRTHAYYTWHRNQDGNAVAADSMWFT NRYWQPTDESLDDSQ</aaseq>

Gene Sequence

<dnaseqindica>3720..3918#3498..3619#2957..3177#2574..2712#2222..2448#2010..2121#1735..1935#273..449#gtcccgtccccgtctccgggattttaatttcttggcacctcgcctcagcatattccatgtcccctctccatccgccccacgcgcccactttgaccgacccatcgatcgatcacgatatttagtagtagtagtagtattacaaatccagcaagcgatcccaatatcccattcccaaaaccccaatccatcctcggagcacgccaccttcacgaggaagagagaatcgaggaagcagagcgctcggaccagaggaggaggaggaggtgccagccatggtggaccggatcggcgccgcgtggtggtgcgcgtgcgccgtggggatgctggtggtgggggcgtgcctcgccggggagaccagcgagtaccggcgccagctcggctccgccgtcgacatgccgctcgacgccgacgtcttccgcgccccgcccggccgcaatgcgccccagcaggtaacccgctgcactctgcactgcatgttcttttctgcatcgcggaaggaaggcatcgatactcgatagactcctccgagggtatcgggtttcgaagccctcgatttgttttcagcatctgtgcagcttcggaggaatcaaatgttcctcttgttccttttgtgatcgatgcttgagatagtagcgtcctgcatctgttcgtgattcgtcactcgtgagccgcacttcgattactgtagattgtataatatactagtactagtactacggagtattttgctgttcgttttgtactcgcgctggtcctgctgagtgctgagtggtggtcatccatttgcatatgcttgtctcatggtgtctccatgctgatgaaacaagcaaggaattttcggtttcgatggtcccgaagttgactgcttgtctctcttcagaaattgtctcctctttaatcacactgtttgtgtttaattcgatcgtttcaatcggataaactgttgtgtttctggttggtagacctgaatttagcgtggcataaatgtttctagctacttgtgttacagggtttctgtcattagtctatcgatgagcatttggcttattcagagtcgtcacctggggtgctttttgcacttagcttaatcccagtccacaaacttggtgtgttcatgaattaaaatactgcttccgtaccaccgcttgctctgcttcactcatttctaaagttaacaccaacttttagggaagtgttccaacttctatcatacactatctgcttgaccatttactagtactaattggttgcagggcccttttacgaacccttttgttgtcttttggaactttcttattcttagggcacccgcaatggttatctataggctctctacaagagatccatgtcagcatatttttctacttggaagaattaaatgtagagagagagcaaagctatctactaacctgaagatagtctatagagaaaaacgaggcaatggattagagagctatagatacccatgtagacataccattaaagtggtttactattaatctagtctattgctgagatgtacatgttttatagatagcaccttactttaccattgcgggtgctcttatagagtcttactcccttgaattaagtattaggatgccttttactgagattgatgtccattcctttttcaatatgccgttagcataaaaaattatatgcaagatgtgctggggtatggtcattggtgtattctccactctgatgcttattgatattgttctctgaaaggttcatatcacacaaggaaatcatgatggcactgccatgataatctcatgggtgacaacaattgagccaggctcaagcactgtgctctatgggacttcggaggataatcttaatttctctgcagatggaaaacacactcagtatacgttctacaactacacctcaggatacattcatcactgtacaataaaaaagttggaggtattagttctttgcaaaagtcgtctttagtgtttggactgtaaattaaagattgactattggctttgttgcagtttgacacaaaatactactatgctgttgggattggacaaaccgtgaggaagttttggttcagaacccctccaaaaagtggcccagatgttccatatacatttggtctcataggtagtattcaatattcctaaattcatttttgctatgtcaggatacacattcaccaaatctataaacgatctatatcactgaaaacaacatctgtattcaggtgatcttggtcagagctacgactcgaatattacgctggcccattatgagtccaattcaaaggcgcaagcagtacttttcgttggggatctgtgttatgcagataactacccataccatgacaatgtgaggtgggatacatgggcaagatttgtagagaggaatgttgcctaccagccttggatctggacagctggaaatcatgagatagattttgccccagaacttgtaagtgtagtactccatttaactttatttgtgtaatgatcttcagtggatgcatatacagttcagtactagataatcagtggagcttatgttataagcatttacattctgttgaacatttgcagggtgaaacgaagccattcaagccatacagctataggtaccccacaccttataaggcttccggtagcacggcacctttctggtattctgtcaaaagagcatctgcttatattattgtcttggcatcatattcatcatatggtatgtaatatgatctagttgcgttttcttttgcatctgtattcaaagtacttagtaacaagcttcacaagtaaaattaaacacccacatgagcaacattgtgaataagtagtcagtcttacatgctttgggcaaacagaaacacacactgtacataacaatgaacttattaacttatactccatttgttgattgctaatagatggaataagataatttatcagttcttctgtttctttcccaggaaagtatactcctcagtacaagtggcttgaagctgagtttcccaaggttaacaggagtgaaacgccatggttgatagtgctattgcatgctccgtggtacaacagctataactatcactacatggaaggtgaaagcatgagagttatgtatgagccgtggttcgtcaagtacaaagttgacctcgtgtttgcaggacatgttcatgcctatgaacggacagtaagcacttacagttttttttcccctgaaaaatagttaaaactttgcatggggaatcaaatggaaatttcttgcaacttcattaggaactttagcacgcacttctttgtcgtctttatatttattagtatatacttgcatctagtaaaattaagttcaacgtgcttgtcgttttctttaaacaaaggagtgcttggttttactacttttttttaaactggtacggagcatgtatagctttactactgatactctgcttagagtagtactagtaccttaatcttgagctgctgacatagacttattttctctgattgcagcacaggatatcaaatgtcgcgtacaacattgtgaatggccagtgcactccagtccatgatcagtctgctccagtctacataaccatcggagatggaggaaaccaggaaggactggccaccaagtaagaatccttttttcgcttccaccaaccgttttcagttcctgaacgctgacaagatatcatgtgcaattgctgggaaaaaaaaacaaatataatgcagcatgacggcgccgcagcctggctactcggccttcagggagtcgagcttcgggcacgccatcctggacatcaagaacaggacgcacgcgtactacacgtggcaccgcaaccaggacggcaacgctgtggcggctgactccatgtggttcaccaacagatactggcagccgacggatgaatctttggacgactcccagtgatctgagtcgttcgtacatggtttactcacacctgctcctcctccctagtttgtgttgtggttcttctacgtgaataagcactggctcgatttgaacacacaggacggactcacggacgcctccggttcaggcgtcgtgatctaggtggttctttctccgctccagctccctcgtggccgtgtgctgcttgtgtatagaagaagcgcagctcacgtgcagcgagaggaaaagaaagctgagaaattgcgagttgatacttgataggcttgtgtacgttcgtactcgtctagatgttgaataaacacattggtttcgtggcgttgcgacttgcatttg</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0776600, RefSeq:Os01g0776600

  1. Tian J, Wang C, Zhang Q, He X, Whelan J, Shou H(2012) Overexpression ofOsPAP10a, a root-associated acid phosphatase, increased extracellular organic phosphorus utilization in rice.J. Integr. Plant Biol.54(9), 631–639.
  2. Zhang Q, Wang C, Tian J, Li K, Shou H(2011) Identification of rice purple acid phosphatases related to phosphate starvation signalling. Plant Biol.13,7–15.