Difference between revisions of "Os12g0100500"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(References)
Line 22: Line 22:
 
==References==
 
==References==
 
Please input cited references here.
 
Please input cited references here.
 +
[1] Nalefski EA, Sultzman LA, Martin DM, Kriz RW, Towler PS, Knopf JL, Clark JD (1994). "Delineation of two functionally distinct domains of cytosolic phospholipase A2, a regulatory Ca(2+)-dependent lipid-binding domain and a Ca(2+)-independent catalytic domain". J. Biol. Chem. 269 (27): 18239–18249. PMID 8027085.
 +
[2]Jump up to: a b Lee KS, Patton JL, Fido M, Hines LK, Kohlwein SD, Paltauf F, Henry SA, Levin DE (1994). "The Saccharomyces cerevisiae PLB1 gene encodes a protein required for lysophospholipase and phospholipase B activity". J. Biol. Chem. 269 (31): 19725–19730. PMID 8051052.
  
 
==Structured Information==
 
==Structured Information==

Revision as of 03:42, 8 June 2014

Please input one-sentence summary here.

Annotated Information

Os12g0100500 in rice hasn't been studied. However, by running blast, we can find that query coverage is 100% with predicted protein [Hordeum vulgare subsp. vulgare]. This gene is predicted to be coding Lysophospholipase [Lipid metabolism]; COG2267.

Function

In enzymology, a lysophospholipase (EC 3.1.1.5) is an enzyme that catalyzes the chemical reaction

2-lysophosphatidylcholine + H2O \rightleftharpoons glycerophosphocholine + a carboxylate Thus, the two substrates of this enzyme are 2-lysophosphatidylcholine and H2O, whereas its two products are glycerophosphocholine and carboxylate. This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. This family consists of lysophospholipase / phospholipase B EC 3.1.1.5 and cytosolic phospholipase A2 which also has a C2 domain IPR000008. Phospholipase B enzymes catalyse the release of fatty acids from lysophospholipids and are capable in vitro of hydrolyzing all phospholipids extractable from yeast cells.[1] Cytosolic phospholipase A2 associates with natural membranes in response to physiological increases in Ca2+ and selectively hydrolyses arachidonyl phospholipids,[2] the aligned region corresponds the carboxy-terminal Ca2+-independent catalytic domain of the protein as discussed in.[2]

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here. [1] Nalefski EA, Sultzman LA, Martin DM, Kriz RW, Towler PS, Knopf JL, Clark JD (1994). "Delineation of two functionally distinct domains of cytosolic phospholipase A2, a regulatory Ca(2+)-dependent lipid-binding domain and a Ca(2+)-independent catalytic domain". J. Biol. Chem. 269 (27): 18239–18249. PMID 8027085. [2]Jump up to: a b Lee KS, Patton JL, Fido M, Hines LK, Kohlwein SD, Paltauf F, Henry SA, Levin DE (1994). "The Saccharomyces cerevisiae PLB1 gene encodes a protein required for lysophospholipase and phospholipase B activity". J. Biol. Chem. 269 (31): 19725–19730. PMID 8051052.

Structured Information

Gene Name

Os12g0100500

Description

Alpha/beta hydrolase family protein

Version

NM_001071764.1 GI:115486849 GeneID:4351238

Length

1294 bp

Definition

Oryza sativa Japonica Group Os12g0100500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 12

Location

Chromosome 12:11806..13099

Sequence Coding Region

11806..12363,12659..13099

Expression

GEO Profiles:Os12g0100500

Genome Context

<gbrowseImage1> name=NC_008405:11806..13099 source=RiceChromosome12 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008405:11806..13099 source=RiceChromosome12 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgagcagcagcagcggcggcgatgggggtgggtacaattactcggaggattgggtggtgaattcgcgagggatgcggctcttcacctgcgcgtggattcccaaggagagcagtagaggcgtggtttgcctgtgccatgggtacgcggtggagtgcagcgtgacgatgcgcggcacggcggagcggctggccagggcgggctacgccgtccacggcatcgactacgagggccacggccactccgacggcctccagggctacgtccccgacctcgacgccctcgtccgcgactgcgactccttcttctccaccgccaccgcctccttcccccgccgcagattcctcctcggcgagtccatgggcggcgccgtcgcccttcttctccaccgcttgcgccccgacttctggaccggcgccattctcgtcgcccccatgtgcaagatcgcggaggagatgcggccgcacccgatggtggtgagcgtgctgaaggtgatgacaagcatcataccgacgtggcgggtggtgccgacgaatgacgtgatcgacctggcatacaggatgcaggggaagcgagacgagatccgagggaacccactgtgctacaagggcaggccccgcctcaagaccgcctacgagctgctccgcgtcagcatcctcatcgagtccaccatcctcccccacgtctccctccccttcctcatcctccacggcgccgccgaccgggtcaccgacccctccgtcagcgacctcctctaccgctccgcctccaccaccgacaagaccttccacctctacaccggcatgtggcacgccctcacctccggcgaactccctcacaacatcgatgccgtcttccgcgacatcatcgactggctccaccacaggacatcccccacctccgcttcacatgtgcaggaccacgacttaagtacgtctttcgaggcggagcgcaaggccaagcacgacgacaccatccattgcggcaagcaaacatcatag</cdnaseq>

Protein Sequence

<aaseq>MSSSSGGDGGGYNYSEDWVVNSRGMRLFTCAWIPKESSRGVVCL CHGYAVECSVTMRGTAERLARAGYAVHGIDYEGHGHSDGLQGYVPDLDALVRDCDSFF STATASFPRRRFLLGESMGGAVALLLHRLRPDFWTGAILVAPMCKIAEEMRPHPMVVS VLKVMTSIIPTWRVVPTNDVIDLAYRMQGKRDEIRGNPLCYKGRPRLKTAYELLRVSI LIESTILPHVSLPFLILHGAADRVTDPSVSDLLYRSASTTDKTFHLYTGMWHALTSGE LPHNIDAVFRDIIDWLHHRTSPTSASHVQDHDLSTSFEAERKAKHDDTIHCGKQTS</aaseq>

Gene Sequence

<dnaseqindica>737..1294#1..441#atgagcagcagcagcggcggcgatgggggtgggtacaattactcggaggattgggtggtgaattcgcgagggatgcggctcttcacctgcgcgtggattcccaaggagagcagtagaggcgtggtttgcctgtgccatgggtacgcggtggagtgcagcgtgacgatgcgcggcacggcggagcggctggccagggcgggctacgccgtccacggcatcgactacgagggccacggccactccgacggcctccagggctacgtccccgacctcgacgccctcgtccgcgactgcgactccttcttctccaccgccaccgcctccttcccccgccgcagattcctcctcggcgagtccatgggcggcgccgtcgcccttcttctccaccgcttgcgccccgacttctggaccggcgccattctcgtcgcccccatgtgcaaggtccgttcaactccatcttaacctttgactctgacttttcctttttctttttgcccgccacatgcatgccatccacgaatcattcagtctacatatgcgtccccaagattagattagatatttagattatactacataacagaacaggctgtctctttctcattttctaagctacctaccggccggccactttcagattattatcttcttttaacgcaacgcaaggaaacgtttctgactgcctcaaatatcatggatgcatgtggttgaatactagtaaaatgcgtggttgcagatcgcggaggagatgcggccgcacccgatggtggtgagcgtgctgaaggtgatgacaagcatcataccgacgtggcgggtggtgccgacgaatgacgtgatcgacctggcatacaggatgcaggggaagcgagacgagatccgagggaacccactgtgctacaagggcaggccccgcctcaagaccgcctacgagctgctccgcgtcagcatcctcatcgagtccaccatcctcccccacgtctccctccccttcctcatcctccacggcgccgccgaccgggtcaccgacccctccgtcagcgacctcctctaccgctccgcctccaccaccgacaagaccttccacctctacaccggcatgtggcacgccctcacctccggcgaactccctcacaacatcgatgccgtcttccgcgacatcatcgactggctccaccacaggacatcccccacctccgcttcacatgtgcaggaccacgacttaagtacgtctttcgaggcggagcgcaaggccaagcacgacgacaccatccattgcggcaagcaaacatcatag</dnaseqindica>

External Link(s)

NCBI Gene:Os12g0100500, RefSeq:Os12g0100500